RL18E - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL18E - 50S ribosomal protein L18e

UniProt:	P95990	Sequences: MKVTGSTNITVRKLIRNLEKSKKPLWRKVAEELSIPSRKRPYINLYKINEHTKPNDIVVVPGKVLGIGKLDHEVTVIALDFSKSAIEKIRASGGQAMSIYKALETFKDFKGRSVRLMKQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	119 (111)
Sequences:	180 (131)
Seq/√Len:	12.4

HALSA - RL18E
SULSO - RL18E

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
52_T	72_H	5.896	1.00
28_K	32_E	3.860	0.99
48_I	64_V	3.378	0.98
48_I	74_V	3.323	0.98
49_N	71_D	3.095	0.97
32_E	41_P	2.622	0.92
95_Q	105_T	2.375	0.87
89_I	94_G	2.371	0.87
56_D	115_R	2.282	0.85
99_I	102_A	1.986	0.75
49_N	72_H	1.951	0.74
81_F	96_A	1.837	0.69
15_I	18_L	1.783	0.67
64_V	81_F	1.710	0.64
19_E	34_S	1.623	0.59
46_Y	51_H	1.608	0.59
64_V	89_I	1.595	0.58
102_A	114_V	1.556	0.56
54_P	72_H	1.540	0.55
66_G	84_S	1.529	0.55
55_N	59_V	1.493	0.53
28_K	41_P	1.493	0.53
8_N	18_L	1.477	0.52
25_L	116_L	1.412	0.49
34_S	79_L	1.383	0.47
77_I	99_I	1.373	0.47
59_V	96_A	1.367	0.46
5_G	12_R	1.334	0.45
8_N	29_V	1.321	0.44
20_K	40_R	1.262	0.41
25_L	49_N	1.248	0.40
46_Y	50_E	1.245	0.40
29_V	74_V	1.238	0.40
42_Y	60_V	1.238	0.40
86_I	90_R	1.234	0.40
76_V	94_G	1.226	0.39
108_D	111_G	1.214	0.39
21_S	25_L	1.201	0.38
6_S	40_R	1.194	0.38
102_A	108_D	1.191	0.38
43_I	117_M	1.171	0.37
83_K	87_E	1.160	0.36
48_I	51_H	1.154	0.36
55_N	103_L	1.147	0.36
7_T	18_L	1.133	0.35
16_R	19_E	1.113	0.34
42_Y	56_D	1.106	0.34
51_H	81_F	1.076	0.32
11_V	24_P	1.067	0.32
46_Y	69_K	1.058	0.32
37_S	88_K	1.039	0.31
16_R	45_L	1.028	0.30
74_V	81_F	1.020	0.30
14_L	98_S	1.009	0.29
102_A	109_F	0.994	0.29
23_K	109_F	0.981	0.28
5_G	16_R	0.973	0.28
14_L	115_R	0.969	0.28
10_T	14_L	0.962	0.27
11_V	31_E	0.962	0.27
24_P	29_V	0.941	0.27
47_K	79_L	0.936	0.26
57_I	87_E	0.934	0.26
28_K	73_E	0.933	0.26
20_K	80_D	0.923	0.26
8_N	97_M	0.918	0.26
40_R	47_K	0.902	0.25
78_A	81_F	0.900	0.25
57_I	104_E	0.897	0.25
15_I	89_I	0.894	0.25
40_R	79_L	0.889	0.25
42_Y	100_Y	0.885	0.24
31_E	87_E	0.884	0.24
7_T	38_R	0.881	0.24
36_P	47_K	0.860	0.24
77_I	108_D	0.859	0.23
20_K	36_P	0.851	0.23
74_V	86_I	0.845	0.23
52_T	71_D	0.844	0.23
73_E	101_K	0.835	0.23
43_I	112_R	0.834	0.23
6_S	9_I	0.815	0.22
13_K	113_S	0.800	0.21
77_I	102_A	0.799	0.21
50_E	70_L	0.783	0.21
6_S	56_D	0.779	0.21
8_N	63_K	0.779	0.21
22_K	29_V	0.774	0.20
9_I	56_D	0.743	0.19
13_K	31_E	0.739	0.19
31_E	39_K	0.722	0.19
25_L	110_K	0.722	0.19
45_L	80_D	0.721	0.19
39_K	45_L	0.718	0.19
45_L	104_E	0.706	0.18
49_N	70_L	0.701	0.18
20_K	93_G	0.697	0.18
21_S	24_P	0.690	0.18
86_I	113_S	0.687	0.18
42_Y	77_I	0.686	0.18
54_P	73_E	0.681	0.18
33_L	78_A	0.676	0.17
5_G	40_R	0.673	0.17
101_K	110_K	0.664	0.17
60_V	64_V	0.656	0.17
57_I	75_T	0.653	0.17
94_G	114_V	0.652	0.17
6_S	32_E	0.650	0.17
83_K	102_A	0.645	0.17
13_K	20_K	0.642	0.16
31_E	91_A	0.640	0.16
52_T	58_V	0.640	0.16
6_S	16_R	0.635	0.16
53_K	114_V	0.630	0.16
16_R	34_S	0.627	0.16
12_R	16_R	0.625	0.16
16_R	92_S	0.624	0.16
77_I	112_R	0.623	0.16
90_R	113_S	0.622	0.16
73_E	87_E	0.620	0.16
71_D	79_L	0.609	0.16
47_K	55_N	0.609	0.16
53_K	72_H	0.606	0.15
27_R	97_M	0.604	0.15
19_E	96_A	0.602	0.15
10_T	100_Y	0.598	0.15
53_K	104_E	0.598	0.15
25_L	100_Y	0.596	0.15
60_V	117_M	0.593	0.15
104_E	112_R	0.587	0.15
29_V	60_V	0.584	0.15
50_E	67_I	0.571	0.15
27_R	90_R	0.569	0.14
8_N	48_I	0.566	0.14
35_I	58_V	0.564	0.14
28_K	99_I	0.561	0.14
58_V	76_V	0.561	0.14
14_L	100_Y	0.558	0.14
91_A	113_S	0.555	0.14
112_R	116_L	0.555	0.14
90_R	95_Q	0.554	0.14
72_H	75_T	0.553	0.14
53_K	67_I	0.549	0.14
23_K	67_I	0.547	0.14
87_E	104_E	0.545	0.14
84_S	95_Q	0.542	0.14
52_T	115_R	0.537	0.14
12_R	70_L	0.534	0.14
54_P	83_K	0.533	0.14
99_I	109_F	0.527	0.13
6_S	39_K	0.524	0.13
14_L	117_M	0.524	0.13
15_I	33_L	0.519	0.13
24_P	116_L	0.518	0.13
43_I	81_F	0.515	0.13
45_L	57_I	0.514	0.13
44_N	94_G	0.513	0.13
29_V	39_K	0.512	0.13
70_L	80_D	0.508	0.13
31_E	40_R	0.506	0.13
59_V	114_V	0.504	0.13
44_N	88_K	0.502	0.13
11_V	29_V	0.502	0.13
31_E	66_G	0.502	0.13
54_P	98_S	0.501	0.13
18_L	30_A	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j21P	1	0.9748	100	0.438	Contact Map
1vq8O	1	0.9328	100	0.467	Contact Map
4w20Q	1	0.9832	100	0.469	Contact Map
4ujrD	1	0.9832	100	0.473	Contact Map
3j39Q	1	0.9832	100	0.474	Contact Map
1vx7S	1	0.9832	100	0.476	Contact Map
3j61Q	1	0.9832	100	0.477	Contact Map
3zf7I	1	0.9832	100	0.479	Contact Map
4a17N	1	0.9832	100	0.48	Contact Map
1vq8L	1	0.8151	99.3	0.725	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.