RS11 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS11 - 30S ribosomal protein S11

UniProt:	P95988	Sequences: MSSRREIRWGIAHIYASQNNTLLTISDLTGAEIISRASGGMVVKADREKSSPYAAMLAANKAASDALEKGIMALHIKVRAPGGYGSKTPGPGAQPAIRALARAGFIIGRIEDVTPIPHDTIRRPGGRRGRRV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	132 (116)
Sequences:	1511 (586)
Seq/√Len:	54.4

ECOLI - RS11
BACSU - RS11
HALSA - RS11
SULSO - RS11

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
24_T	32_E	3.815	1.00
11_I	77_K	3.705	1.00
10_G	71_I	3.679	1.00
27_D	31_A	3.409	1.00
74_L	105_F	3.398	1.00
36_R	61_K	2.891	1.00
12_A	25_I	2.783	1.00
62_A	66_A	2.758	1.00
75_H	109_R	2.583	1.00
75_H	108_G	2.519	1.00
63_A	103_A	2.406	1.00
12_A	74_L	2.395	1.00
61_K	65_D	2.206	1.00
73_A	106_I	2.142	1.00
5_R	69_K	2.138	1.00
9_W	73_A	2.003	1.00
33_I	71_I	1.996	1.00
36_R	40_G	1.980	1.00
76_I	100_L	1.872	0.99
67_L	72_M	1.720	0.99
25_I	62_A	1.685	0.99
100_L	105_F	1.682	0.99
7_I	33_I	1.619	0.98
33_I	69_K	1.615	0.98
14_I	96_A	1.593	0.98
23_L	62_A	1.573	0.98
21_T	50_S	1.520	0.98
18_Q	89_P	1.455	0.97
59_A	63_A	1.417	0.96
25_I	66_A	1.377	0.96
64_S	67_L	1.373	0.96
7_I	69_K	1.330	0.95
77_K	113_V	1.309	0.94
12_A	100_L	1.274	0.93
34_I	62_A	1.261	0.93
46_D	50_S	1.226	0.92
6_E	69_K	1.190	0.91
73_A	108_G	1.178	0.90
64_S	68_E	1.166	0.90
13_H	26_S	1.146	0.89
13_H	113_V	1.144	0.89
4_R	69_K	1.130	0.88
36_R	41_M	1.101	0.87
40_G	65_D	1.050	0.84
9_W	28_L	1.045	0.84
41_M	57_L	1.016	0.82
101_A	107_I	1.009	0.82
19_N	49_K	1.002	0.81
40_G	61_K	0.994	0.81
77_K	109_R	0.989	0.81
78_V	97_I	0.985	0.80
117_P	120_T	0.974	0.80
15_Y	22_L	0.963	0.79
8_R	32_E	0.938	0.77
21_T	47_R	0.933	0.77
93_A	112_D	0.920	0.76
15_Y	91_P	0.918	0.75
97_I	106_I	0.916	0.75
41_M	53_Y	0.902	0.74
52_P	91_P	0.894	0.73
8_R	28_L	0.894	0.73
92_G	114_T	0.885	0.73
25_I	100_L	0.881	0.72
14_I	97_I	0.878	0.72
38_S	41_M	0.871	0.71
8_R	71_I	0.854	0.70
53_Y	57_L	0.854	0.70
4_R	95_P	0.835	0.68
11_I	28_L	0.834	0.68
43_V	56_M	0.799	0.65
17_S	91_P	0.790	0.64
63_A	74_L	0.787	0.64
94_Q	98_R	0.784	0.63
53_Y	60_N	0.783	0.63
43_V	127_R	0.782	0.63
42_V	61_K	0.769	0.62
77_K	111_E	0.766	0.62
20_N	120_T	0.766	0.62
4_R	8_R	0.765	0.61
47_R	118_H	0.749	0.60
25_I	105_F	0.749	0.60
14_I	57_L	0.745	0.59
27_D	102_R	0.743	0.59
9_W	29_T	0.742	0.59
15_Y	127_R	0.741	0.59
37_A	42_V	0.737	0.59
66_A	69_K	0.732	0.58
22_L	121_I	0.729	0.58
42_V	80_A	0.726	0.57
89_P	99_A	0.725	0.57
14_I	113_V	0.721	0.57
18_Q	60_N	0.718	0.57
41_M	61_K	0.717	0.56
78_V	96_A	0.715	0.56
12_A	17_S	0.712	0.56
18_Q	50_S	0.712	0.56
64_S	77_K	0.711	0.56
41_M	58_A	0.707	0.55
13_H	77_K	0.705	0.55
41_M	127_R	0.705	0.55
5_R	68_E	0.702	0.55
63_A	105_F	0.693	0.54
19_N	127_R	0.692	0.54
16_A	97_I	0.689	0.53
44_K	65_D	0.683	0.53
118_H	121_I	0.683	0.53
37_A	80_A	0.683	0.53
16_A	57_L	0.680	0.53
43_V	49_K	0.670	0.51
21_T	55_A	0.667	0.51
50_S	58_A	0.666	0.51
44_K	60_N	0.662	0.51
49_K	109_R	0.658	0.50
6_E	71_I	0.656	0.50
16_A	92_G	0.654	0.50
34_I	68_E	0.652	0.50
57_L	60_N	0.650	0.49
43_V	114_T	0.647	0.49
26_S	30_G	0.644	0.49
16_A	98_R	0.643	0.49
35_S	104_G	0.630	0.47
28_L	47_R	0.615	0.46
35_S	118_H	0.610	0.45
24_T	108_G	0.602	0.44
120_T	123_R	0.597	0.44
24_T	30_G	0.597	0.44
49_K	78_V	0.596	0.44
16_A	52_P	0.591	0.43
71_I	96_A	0.583	0.42
36_R	62_A	0.577	0.42
8_R	29_T	0.573	0.41
63_A	67_L	0.571	0.41
28_L	106_I	0.570	0.41
15_Y	111_E	0.569	0.41
63_A	100_L	0.568	0.41
94_Q	110_I	0.565	0.40
50_S	91_P	0.564	0.40
59_A	103_A	0.561	0.40
120_T	125_G	0.559	0.40
65_D	69_K	0.559	0.40
23_L	34_I	0.554	0.39
9_W	106_I	0.554	0.39
60_N	64_S	0.554	0.39
28_L	32_E	0.550	0.39
11_I	107_I	0.550	0.39
8_R	77_K	0.548	0.39
56_M	93_A	0.548	0.39
43_V	54_A	0.546	0.38
14_I	19_N	0.546	0.38
69_K	95_P	0.536	0.37
15_Y	124_P	0.535	0.37
17_S	75_H	0.534	0.37
122_R	127_R	0.532	0.37
12_A	97_I	0.532	0.37
62_A	69_K	0.532	0.37
79_R	113_V	0.532	0.37
45_A	49_K	0.531	0.37
28_L	75_H	0.531	0.37
22_L	59_A	0.529	0.37
89_P	95_P	0.523	0.36
40_G	79_R	0.519	0.36
108_G	115_P	0.518	0.36
4_R	79_R	0.517	0.36
89_P	111_E	0.517	0.36
73_A	95_P	0.514	0.35
92_G	98_R	0.513	0.35
33_I	49_K	0.510	0.35
19_N	128_R	0.508	0.35
38_S	58_A	0.508	0.35
35_S	38_S	0.508	0.35
107_I	111_E	0.503	0.34
74_L	107_I	0.502	0.34
91_P	101_A	0.501	0.34
69_K	91_P	0.500	0.34

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3zeyH	1	0.8864	100	0.087	Contact Map
4ujpP	1	0.9545	100	0.087	Contact Map
3j7aP	1	0.9621	100	0.088	Contact Map
4cvnE	1	0.947	100	0.113	Contact Map
4tp8K	1	0.0152	100	0.184	Contact Map
3bbnK	1	0.8864	100	0.187	Contact Map
4rb5K	1	0.8636	100	0.188	Contact Map
5aj3K	1	0.9091	100	0.193	Contact Map
1ovyA	1	0.7197	93.8	0.892	Contact Map
3j7yP	1	0.803	92.6	0.897	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.