RS13 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS13 - 30S ribosomal protein S13

UniProt:	P95986	Sequences: MSQQFKYVVRIFGQDVDGTMKLPYALAMVKGIGYNTAKAIIRKLGMDPNARLGELSDAEVKKVESVISDHTIKGLPSWLYNRRKDYESGLDLHLVTSDLIFYVRNDIEREKKSRSWRGVRHSLGLKVRGQRTRTTGRTGMTIGVARKKAAQPQSQQSSSQQQKSS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	165 (146)
Sequences:	394 (245)
Seq/√Len:	20.2

ECOLI - RS13
BACSU - RS13
HALSA - RS13
SULSO - RS13

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
126_K	136_G	4.010	1.00
50_A	59_E	3.966	1.00
22_L	46_M	3.371	1.00
110_E	117_R	3.357	1.00
110_E	115_S	3.266	1.00
118_G	121_H	2.662	0.98
23_P	38_K	2.653	0.98
56_S	59_E	2.513	0.98
11_I	60_V	2.257	0.95
83_R	91_D	2.220	0.95
40_I	66_V	2.147	0.94
41_I	46_M	1.989	0.91
114_R	122_S	1.988	0.91
6_K	57_D	1.982	0.91
82_R	85_D	1.909	0.89
106_D	121_H	1.894	0.89
36_T	70_H	1.861	0.88
38_K	42_R	1.824	0.87
5_F	96_T	1.787	0.85
25_A	52_L	1.785	0.85
108_E	111_K	1.671	0.81
138_T	141_T	1.635	0.80
103_V	107_I	1.603	0.78
110_E	116_W	1.591	0.78
69_D	115_S	1.540	0.75
10_R	137_R	1.497	0.73
89_G	93_H	1.490	0.73
76_P	81_N	1.489	0.73
7_Y	70_H	1.485	0.73
64_E	68_S	1.467	0.72
109_R	117_R	1.466	0.72
139_G	143_G	1.454	0.71
50_A	56_S	1.452	0.71
78_W	81_N	1.447	0.71
41_I	79_L	1.429	0.70
16_V	28_M	1.381	0.67
78_W	82_R	1.350	0.65
57_D	64_E	1.349	0.65
9_V	52_L	1.348	0.65
70_H	75_L	1.342	0.65
139_G	144_V	1.340	0.65
23_P	37_A	1.338	0.65
4_Q	16_V	1.334	0.64
106_D	118_G	1.317	0.63
3_Q	56_S	1.307	0.63
94_L	131_R	1.292	0.62
16_V	41_I	1.279	0.61
71_T	77_S	1.269	0.60
24_Y	134_T	1.260	0.60
18_G	85_D	1.255	0.59
81_N	85_D	1.250	0.59
8_V	12_F	1.237	0.58
119_V	123_L	1.190	0.55
86_Y	109_R	1.185	0.55
4_Q	24_Y	1.168	0.54
22_L	41_I	1.163	0.54
8_V	133_R	1.159	0.53
12_F	140_M	1.153	0.53
78_W	85_D	1.146	0.52
44_L	66_V	1.104	0.50
96_T	126_K	1.089	0.49
20_M	24_Y	1.085	0.48
5_F	51_R	1.085	0.48
116_W	134_T	1.049	0.46
102_Y	113_S	1.040	0.46
9_V	16_V	1.040	0.46
7_Y	36_T	1.037	0.45
76_P	89_G	1.034	0.45
16_V	60_V	1.034	0.45
47_D	50_A	1.033	0.45
75_L	79_L	1.030	0.45
108_E	122_S	1.023	0.44
76_P	82_R	1.005	0.43
28_M	87_E	0.999	0.43
94_L	99_L	0.994	0.43
51_R	148_K	0.993	0.43
50_A	54_E	0.988	0.42
81_N	89_G	0.981	0.42
28_M	63_V	0.973	0.41
60_V	84_K	0.971	0.41
33_G	104_R	0.963	0.41
18_G	53_G	0.957	0.40
106_D	110_E	0.950	0.40
4_Q	142_I	0.949	0.40
30_K	100_I	0.939	0.39
57_D	65_S	0.926	0.38
21_K	50_A	0.923	0.38
133_R	138_T	0.923	0.38
32_I	36_T	0.907	0.37
18_G	143_G	0.900	0.37
15_D	88_S	0.892	0.36
78_W	89_G	0.890	0.36
14_Q	46_M	0.889	0.36
19_T	96_T	0.879	0.35
33_G	53_G	0.870	0.35
74_G	84_K	0.869	0.35
61_K	138_T	0.868	0.35
48_P	100_I	0.855	0.34
5_F	16_V	0.845	0.33
45_G	91_D	0.843	0.33
139_G	147_K	0.838	0.33
120_R	137_R	0.836	0.33
55_L	99_L	0.829	0.33
141_T	145_A	0.815	0.32
60_V	105_N	0.811	0.31
63_V	66_V	0.806	0.31
34_Y	75_L	0.806	0.31
56_S	125_L	0.805	0.31
8_V	92_L	0.804	0.31
40_I	45_G	0.802	0.31
63_V	145_A	0.798	0.31
18_G	81_N	0.794	0.31
82_R	106_D	0.791	0.30
108_E	124_G	0.791	0.30
116_W	126_K	0.786	0.30
143_G	146_R	0.785	0.30
76_P	85_D	0.780	0.30
23_P	142_I	0.777	0.30
48_P	63_V	0.776	0.30
4_Q	73_K	0.775	0.30
29_V	146_R	0.769	0.29
53_G	76_P	0.766	0.29
40_I	110_E	0.753	0.28
126_K	135_T	0.749	0.28
45_G	75_L	0.748	0.28
67_I	95_V	0.742	0.28
4_Q	11_I	0.739	0.28
139_G	146_R	0.730	0.27
97_S	123_L	0.729	0.27
97_S	104_R	0.727	0.27
40_I	69_D	0.726	0.27
96_T	136_G	0.721	0.27
141_T	146_R	0.720	0.27
70_H	74_G	0.720	0.27
42_R	142_I	0.712	0.26
116_W	121_H	0.711	0.26
30_K	138_T	0.705	0.26
5_F	19_T	0.704	0.26
135_T	142_I	0.702	0.26
17_D	99_L	0.698	0.26
107_I	128_R	0.694	0.25
30_K	40_I	0.694	0.25
55_L	97_S	0.692	0.25
16_V	109_R	0.680	0.25
56_S	62_K	0.679	0.25
25_A	114_R	0.675	0.24
49_N	77_S	0.671	0.24
62_K	112_K	0.668	0.24
144_V	147_K	0.667	0.24
3_Q	12_F	0.661	0.24
103_V	140_M	0.659	0.24
7_Y	104_R	0.652	0.23
65_S	71_T	0.652	0.23
77_S	91_D	0.648	0.23
53_G	82_R	0.640	0.23
10_R	120_R	0.634	0.22
23_P	26_L	0.629	0.22
108_E	114_R	0.628	0.22
32_I	71_T	0.624	0.22
116_W	131_R	0.620	0.22
11_I	16_V	0.620	0.22
108_E	126_K	0.616	0.22
50_A	110_E	0.614	0.22
4_Q	45_G	0.613	0.22
35_N	134_T	0.607	0.21
16_V	22_L	0.603	0.21
18_G	89_G	0.601	0.21
47_D	82_R	0.600	0.21
61_K	68_S	0.599	0.21
36_T	74_G	0.597	0.21
20_M	57_D	0.596	0.21
39_A	94_L	0.595	0.21
5_F	105_N	0.595	0.21
25_A	125_L	0.592	0.21
78_W	144_V	0.591	0.21
71_T	91_D	0.590	0.21
60_V	86_Y	0.585	0.20
136_G	139_G	0.584	0.20
65_S	73_K	0.584	0.20
22_L	74_G	0.584	0.20
4_Q	22_L	0.582	0.20
80_Y	146_R	0.581	0.20
39_A	88_S	0.581	0.20
130_Q	137_R	0.580	0.20
65_S	68_S	0.580	0.20
54_E	92_L	0.578	0.20
9_V	122_S	0.576	0.20
129_G	132_T	0.568	0.20
84_K	142_I	0.563	0.19
21_K	49_N	0.561	0.19
129_G	137_R	0.560	0.19
20_M	131_R	0.559	0.19
64_E	116_W	0.557	0.19
139_G	148_K	0.551	0.19
36_T	72_I	0.550	0.19
37_A	115_S	0.548	0.19
99_L	138_T	0.548	0.19
26_L	67_I	0.546	0.19
10_R	35_N	0.543	0.19
81_N	144_V	0.537	0.18
63_V	95_V	0.535	0.18
78_W	106_D	0.531	0.18
26_L	120_R	0.529	0.18
102_Y	106_D	0.528	0.18
49_N	124_G	0.528	0.18
43_K	54_E	0.528	0.18
86_Y	99_L	0.526	0.18
25_A	105_N	0.526	0.18
101_F	107_I	0.522	0.18
49_N	95_V	0.519	0.18
13_G	35_N	0.513	0.17
11_I	40_I	0.513	0.17
17_D	80_Y	0.512	0.17
6_K	25_A	0.511	0.17
89_G	144_V	0.510	0.17
34_Y	44_L	0.510	0.17
27_A	34_Y	0.506	0.17
32_I	102_Y	0.505	0.17
59_E	66_V	0.500	0.17

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j60S	1	0.897	100	0.143	Contact Map
4bpeM	1	0.897	100	0.146	Contact Map
3j7aS	1	0.7758	100	0.147	Contact Map
3j38S	1	0.8303	100	0.147	Contact Map
3j20O	1	0.897	100	0.147	Contact Map
3zeyM	1	0.897	100	0.147	Contact Map
4ujpT	1	0.8485	100	0.198	Contact Map
4rb5M	1	0.7212	100	0.397	Contact Map
4tp8M	1	0.6909	100	0.442	Contact Map
3bbnM	1	0.6	100	0.468	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.