Y099 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Y099 - UPF0173 metal-dependent hydrolase SSO0099

UniProt:	P95962	Sequences: MAQLRWLGHAATLLTFGNKNVIIDPMIKDNPLSPVKLDYFKNNLDIIIVTHDHYDHLGDTVELLRMNPKAKLFATYDLEAHLAETYKISEESIIPANVGGFVEVDGIKLALTKAVHSSTHSDPTGAIVSAEGITVYHAGDTGLFEDMKLIGEVFKPDYALLPIGGRFTMDPYQASISVELIKPKKGAIPIHYNTWDLIKVDVNDFVKLVKNKGYNPIVLQPGQTITL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	227 (214)
Sequences:	5330 (3750)
Seq/√Len:	256.4

ECOLI - ULAG
BACSU - YTKL YDDR
HALSA - Q9HR59 Y1038 Q9HR33
SULSO - Y099 Q97W37

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
12_T	190_I	3.234	1.00
111_L	124_T	3.173	1.00
108_K	129_S	2.855	1.00
129_S	134_T	2.843	1.00
71_K	94_I	2.700	1.00
112_T	127_I	2.659	1.00
15_T	20_N	2.652	1.00
159_A	183_P	2.592	1.00
178_V	187_A	2.509	1.00
101_F	108_K	2.459	1.00
50_T	137_H	2.384	1.00
172_Y	208_L	2.276	1.00
143_L	180_L	2.226	1.00
5_R	224_T	2.186	1.00
220_Q	223_Q	2.148	1.00
110_A	129_S	2.102	1.00
103_E	108_K	2.086	1.00
79_E	95_P	2.085	1.00
157_D	184_K	2.078	1.00
21_V	46_I	2.068	1.00
3_Q	15_T	2.014	1.00
135_V	160_L	2.013	1.00
36_K	39_Y	2.007	1.00
138_A	162_P	1.994	1.00
19_K	105_D	1.986	1.00
112_T	125_G	1.974	1.00
169_M	177_S	1.965	1.00
23_I	50_T	1.961	1.00
148_K	152_E	1.942	1.00
160_L	188_I	1.922	1.00
127_I	154_F	1.922	1.00
96_A	111_L	1.913	1.00
165_G	170_D	1.879	1.00
101_F	110_A	1.859	1.00
148_K	180_L	1.836	1.00
13_L	20_N	1.825	1.00
12_T	160_L	1.823	1.00
48_I	126_A	1.777	1.00
48_I	128_V	1.709	1.00
110_A	154_F	1.701	1.00
186_G	217_I	1.696	1.00
203_N	207_K	1.674	1.00
178_V	183_P	1.636	1.00
117_S	167_F	1.626	1.00
79_E	83_A	1.614	1.00
176_I	180_L	1.589	1.00
204_D	208_L	1.529	1.00
138_A	161_L	1.521	1.00
4_L	158_Y	1.518	1.00
176_I	179_E	1.515	1.00
46_I	71_K	1.482	1.00
158_Y	188_I	1.436	1.00
16_F	130_A	1.433	1.00
103_E	106_G	1.412	1.00
28_K	58_G	1.398	1.00
76_Y	97_N	1.389	1.00
46_I	104_V	1.387	1.00
46_I	73_F	1.367	1.00
186_G	215_N	1.322	1.00
23_I	137_H	1.307	1.00
208_L	211_N	1.301	1.00
3_Q	224_T	1.294	1.00
99_G	113_K	1.273	1.00
160_L	190_I	1.262	1.00
163_I	174_A	1.249	1.00
19_K	45_D	1.246	1.00
14_L	135_V	1.237	1.00
7_L	34_P	1.230	1.00
23_I	128_V	1.219	1.00
151_G	182_K	1.215	1.00
11_A	23_I	1.214	1.00
48_I	109_L	1.213	1.00
60_T	72_L	1.211	1.00
47_I	72_L	1.210	1.00
137_H	190_I	1.209	1.00
204_D	207_K	1.208	1.00
4_L	12_T	1.184	1.00
94_I	102_V	1.161	1.00
111_L	126_A	1.159	1.00
52_D	81_H	1.143	1.00
27_I	37_L	1.142	1.00
19_K	107_I	1.141	1.00
109_L	126_A	1.132	1.00
73_F	102_V	1.129	1.00
74_A	78_L	1.121	1.00
7_L	11_A	1.120	1.00
147_M	177_S	1.115	1.00
97_N	117_S	1.110	1.00
170_D	173_Q	1.109	1.00
209_V	216_P	1.100	1.00
5_R	15_T	1.073	1.00
71_K	92_S	1.072	1.00
149_L	153_V	1.072	1.00
174_A	187_A	1.065	1.00
138_A	159_A	1.057	1.00
74_A	79_E	1.053	1.00
62_E	66_M	1.052	1.00
72_L	88_I	1.050	1.00
13_L	44_L	1.050	1.00
96_A	100_G	1.049	1.00
149_L	152_E	1.044	1.00
112_T	136_Y	1.040	1.00
207_K	211_N	1.037	1.00
73_F	96_A	1.027	1.00
143_L	176_I	1.019	1.00
99_G	153_V	1.009	1.00
158_Y	186_G	1.008	1.00
60_T	64_L	1.007	1.00
26_M	31_P	1.005	1.00
159_A	181_I	0.997	1.00
161_L	177_S	0.997	1.00
40_F	44_L	0.992	1.00
125_G	138_A	0.988	1.00
13_L	22_I	0.986	1.00
14_L	23_I	0.985	1.00
22_I	44_L	0.979	1.00
20_N	44_L	0.978	1.00
4_L	160_L	0.976	1.00
219_L	224_T	0.968	1.00
175_S	212_K	0.968	1.00
179_E	212_K	0.965	1.00
205_F	209_V	0.963	1.00
75_T	124_T	0.955	1.00
208_L	212_K	0.953	1.00
99_G	154_F	0.951	1.00
178_V	209_V	0.944	1.00
21_V	107_I	0.944	1.00
97_N	100_G	0.929	1.00
76_Y	80_A	0.924	1.00
188_I	217_I	0.913	1.00
20_N	43_N	0.907	1.00
187_A	216_P	0.899	1.00
7_L	13_L	0.895	1.00
69_K	92_S	0.888	1.00
127_I	156_P	0.883	1.00
161_L	181_I	0.881	1.00
94_I	166_R	0.868	1.00
201_D	204_D	0.867	1.00
115_V	144_F	0.865	1.00
7_L	27_I	0.857	0.99
200_V	205_F	0.854	0.99
138_A	141_T	0.851	0.99
96_A	102_V	0.849	0.99
61_V	65_R	0.848	0.99
74_A	126_A	0.847	0.99
23_I	48_I	0.845	0.99
20_N	45_D	0.843	0.99
127_I	150_I	0.838	0.99
130_A	133_I	0.833	0.99
6_W	190_I	0.832	0.99
206_V	210_K	0.828	0.99
203_N	206_V	0.820	0.99
202_V	205_F	0.818	0.99
80_A	83_A	0.818	0.99
125_G	136_Y	0.817	0.99
19_K	46_I	0.816	0.99
159_A	178_V	0.809	0.99
133_I	157_D	0.803	0.99
51_H	140_D	0.800	0.99
59_D	62_E	0.798	0.99
114_A	141_T	0.796	0.99
145_E	149_L	0.794	0.99
33_S	36_K	0.791	0.99
12_T	188_I	0.789	0.99
161_L	178_V	0.786	0.99
130_A	135_V	0.785	0.99
5_R	13_L	0.784	0.99
186_G	189_P	0.781	0.99
73_F	109_L	0.781	0.99
109_L	128_V	0.780	0.99
73_F	126_A	0.778	0.99
63_L	66_M	0.778	0.99
79_E	93_I	0.771	0.99
151_G	181_I	0.769	0.99
151_G	156_P	0.769	0.99
170_D	174_A	0.768	0.99
48_I	124_T	0.768	0.99
145_E	148_K	0.768	0.99
128_V	135_V	0.767	0.99
192_Y	206_V	0.765	0.99
72_L	82_L	0.763	0.99
98_V	124_T	0.763	0.99
75_T	78_L	0.759	0.99
11_A	27_I	0.752	0.99
161_L	169_M	0.751	0.99
171_P	204_D	0.750	0.99
27_I	59_D	0.750	0.99
59_D	63_L	0.746	0.99
134_T	157_D	0.745	0.99
73_F	104_V	0.745	0.99
163_I	192_Y	0.745	0.99
10_A	190_I	0.743	0.99
28_K	59_D	0.739	0.98
171_P	200_V	0.738	0.98
51_H	191_H	0.735	0.98
64_L	88_I	0.733	0.98
175_S	179_E	0.732	0.98
74_A	93_I	0.723	0.98
76_Y	95_P	0.723	0.98
19_K	106_G	0.720	0.98
7_L	33_S	0.720	0.98
46_I	109_L	0.716	0.98
141_T	147_M	0.714	0.98
21_V	109_L	0.712	0.98
60_T	63_L	0.710	0.98
17_G	130_A	0.708	0.98
134_T	155_K	0.705	0.98
151_G	159_A	0.702	0.98
164_G	168_T	0.700	0.98
134_T	154_F	0.693	0.98
165_G	200_V	0.693	0.98
136_Y	181_I	0.682	0.97
16_F	21_V	0.681	0.97
206_V	218_V	0.678	0.97
35_V	39_Y	0.675	0.97
78_L	82_L	0.673	0.97
50_T	126_A	0.672	0.97
16_F	107_I	0.672	0.97
4_L	14_L	0.670	0.97
98_V	142_G	0.668	0.97
38_D	66_M	0.667	0.97
136_Y	177_S	0.667	0.97
16_F	131_E	0.664	0.97
11_A	33_S	0.662	0.97
14_L	21_V	0.659	0.97
207_K	210_K	0.657	0.97
60_T	82_L	0.657	0.97
133_I	158_Y	0.656	0.97
10_A	162_P	0.652	0.97
64_L	72_L	0.651	0.97
175_S	208_L	0.651	0.97
76_Y	79_E	0.650	0.97
119_T	122_D	0.649	0.97
60_T	88_I	0.647	0.97
52_D	78_L	0.647	0.97
15_T	18_N	0.646	0.97
61_V	64_L	0.645	0.96
87_K	91_E	0.644	0.96
162_P	174_A	0.641	0.96
129_S	154_F	0.639	0.96
137_H	160_L	0.639	0.96
59_D	65_R	0.634	0.96
17_G	132_G	0.632	0.96
53_H	140_D	0.626	0.96
11_A	58_G	0.624	0.96
187_A	214_Y	0.624	0.96
88_I	93_I	0.623	0.96
11_A	26_M	0.621	0.96
99_G	150_I	0.620	0.96
104_V	107_I	0.616	0.95
134_T	156_P	0.616	0.95
74_A	82_L	0.611	0.95
81_H	84_E	0.609	0.95
135_V	158_Y	0.605	0.95
4_L	188_I	0.605	0.95
163_I	189_P	0.604	0.95
116_H	191_H	0.600	0.95
75_T	111_L	0.599	0.95
171_P	175_S	0.598	0.95
51_H	116_H	0.593	0.94
141_T	169_M	0.593	0.94
61_V	66_M	0.592	0.94
38_D	62_E	0.585	0.94
110_A	127_I	0.585	0.94
189_P	218_V	0.585	0.94
128_V	137_H	0.583	0.94
57_L	82_L	0.581	0.94
143_L	147_M	0.580	0.94
99_G	112_T	0.579	0.94
17_G	133_I	0.577	0.94
49_V	78_L	0.574	0.93
173_Q	176_I	0.573	0.93
64_L	69_K	0.568	0.93
115_V	142_G	0.568	0.93
83_A	87_K	0.568	0.93
178_V	214_Y	0.567	0.93
64_L	70_A	0.566	0.93
183_P	187_A	0.566	0.93
52_D	119_T	0.563	0.93
118_S	123_P	0.560	0.93
75_T	126_A	0.559	0.92
83_A	93_I	0.559	0.92
189_P	205_F	0.559	0.92
214_Y	217_I	0.556	0.92
189_P	192_Y	0.553	0.92
219_L	223_Q	0.552	0.92
112_T	153_V	0.550	0.92
165_G	197_L	0.546	0.92
6_W	221_P	0.546	0.92
6_W	192_Y	0.545	0.92
62_E	65_R	0.540	0.91
22_I	40_F	0.539	0.91
144_F	150_I	0.538	0.91
127_I	134_T	0.535	0.91
177_S	189_P	0.535	0.91
35_V	40_F	0.533	0.91
175_S	209_V	0.528	0.90
99_G	149_L	0.527	0.90
141_T	144_F	0.527	0.90
16_F	19_K	0.526	0.90
13_L	40_F	0.524	0.90
16_F	128_V	0.522	0.90
65_R	69_K	0.521	0.90
57_L	78_L	0.520	0.90
73_F	81_H	0.520	0.90
6_W	193_N	0.518	0.89
203_N	220_Q	0.518	0.89
106_G	131_E	0.516	0.89
179_E	182_K	0.516	0.89
177_S	181_I	0.515	0.89
196_D	199_K	0.514	0.89
51_H	55_D	0.514	0.89
195_W	198_I	0.511	0.89
69_K	91_E	0.508	0.88
201_D	205_F	0.505	0.88
14_L	128_V	0.505	0.88
144_F	147_M	0.504	0.88
209_V	218_V	0.502	0.88
142_G	173_Q	0.501	0.88
6_W	12_T	0.501	0.88
114_A	150_I	0.500	0.88

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4qn9A	2	0.978	100	0.338	Contact Map
3rpcA	2	0.9692	100	0.343	Contact Map
3bv6A	5	0.9868	100	0.417	Contact Map
2wylA	5	0.978	100	0.441	Contact Map
4jo0A	2	0.9692	100	0.472	Contact Map
2cbnA	2	0.9648	100	0.504	Contact Map
3kl7A	1	0.8722	100	0.508	Contact Map
1zkpA	2	0.9427	100	0.51	Contact Map
1y44A	2	0.9604	100	0.526	Contact Map
3zwfA	2	0.8899	100	0.539	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0081 seconds.