YHIT - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YHIT - Uncharacterized HIT-like protein SSO2163

UniProt:	P95937	Sequences: MCIFCNIVEGRDHGYIVYSNDRVVAFLDKFPITPGHTLVVPRTHYENFLEISEDVIPYLCTAVRKISIAVKKALKADGIRILTNIGKSAGQVVFHSHFHIVPTWSQDPDIMKDFVPRKEQSREYYEYVQKAIIETLKNI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	139 (123)
Sequences:	4827 (3128)
Seq/√Len:	282.0

ECOLI - HINT
BACSU - HIT
HALSA - Q9HNA0 Q9HP05
SULSO - YHIT Q980P0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
2_C	5_C	3.158	1.00
43_T	55_V	3.014	1.00
19_S	42_R	2.992	1.00
22_R	58_Y	2.884	1.00
5_C	44_H	2.657	1.00
53_E	64_R	2.573	1.00
2_C	44_H	2.460	1.00
23_V	62_A	2.448	1.00
52_S	55_V	2.382	1.00
20_N	58_Y	2.366	1.00
26_F	40_V	2.116	1.00
63_V	98_F	2.104	1.00
10_G	16_I	2.085	1.00
6_N	11_R	2.037	1.00
51_I	96_S	1.973	1.00
15_Y	126_E	1.962	1.00
23_V	58_Y	1.867	1.00
16_I	24_V	1.842	1.00
83_T	98_F	1.754	1.00
17_V	37_T	1.723	1.00
37_T	66_I	1.710	1.00
77_D	88_S	1.708	1.00
53_E	61_T	1.691	1.00
43_T	52_S	1.682	1.00
5_C	9_E	1.677	1.00
57_P	61_T	1.663	1.00
59_L	98_F	1.600	1.00
18_Y	62_A	1.580	1.00
56_I	64_R	1.554	1.00
80_R	103_T	1.549	1.00
69_A	73_A	1.536	1.00
56_I	60_C	1.526	1.00
14_G	24_V	1.521	1.00
24_V	42_R	1.470	1.00
15_Y	27_L	1.462	1.00
45_Y	52_S	1.392	1.00
64_R	68_I	1.383	1.00
71_K	79_I	1.360	1.00
34_P	124_Y	1.353	1.00
47_N	50_E	1.332	1.00
16_I	19_S	1.325	1.00
45_Y	55_V	1.303	1.00
88_S	105_S	1.295	1.00
7_I	14_G	1.236	1.00
39_V	100_I	1.200	1.00
45_Y	51_I	1.195	1.00
27_L	37_T	1.175	1.00
48_F	60_C	1.118	1.00
24_V	40_V	1.084	1.00
49_L	71_K	1.079	1.00
60_C	98_F	1.070	1.00
47_N	85_I	1.058	1.00
25_A	37_T	1.056	1.00
59_L	96_S	1.025	1.00
87_K	94_F	1.009	1.00
47_N	86_G	1.005	1.00
33_T	104_W	1.003	1.00
46_E	50_E	0.994	1.00
120_Q	125_Y	0.979	1.00
83_T	96_S	0.961	1.00
60_C	63_V	0.953	1.00
22_R	55_V	0.952	1.00
25_A	66_I	0.934	1.00
58_Y	62_A	0.924	1.00
47_N	94_F	0.921	1.00
46_E	86_G	0.912	1.00
67_S	79_I	0.906	1.00
115_V	118_K	0.905	1.00
4_F	93_V	0.902	1.00
6_N	12_D	0.902	1.00
35_G	102_P	0.896	1.00
76_A	104_W	0.893	1.00
111_M	114_F	0.892	1.00
80_R	84_N	0.892	1.00
20_N	65_K	0.882	1.00
47_N	71_K	0.880	1.00
8_V	24_V	0.872	1.00
49_L	79_I	0.858	1.00
53_E	57_P	0.855	1.00
33_T	101_V	0.853	1.00
63_V	81_I	0.851	1.00
78_G	88_S	0.849	1.00
77_D	105_S	0.848	1.00
39_V	63_V	0.842	1.00
45_Y	96_S	0.832	1.00
15_Y	125_Y	0.832	1.00
115_V	119_E	0.829	1.00
77_D	104_W	0.791	0.99
55_V	58_Y	0.785	0.99
67_S	71_K	0.785	0.99
117_R	120_Q	0.783	0.99
23_V	59_L	0.783	0.99
20_N	62_A	0.782	0.99
46_E	94_F	0.774	0.99
3_I	6_N	0.773	0.99
120_Q	124_Y	0.772	0.99
8_V	40_V	0.768	0.99
79_I	100_I	0.765	0.99
110_I	113_D	0.754	0.99
51_I	55_V	0.741	0.99
61_T	65_K	0.734	0.99
114_F	117_R	0.733	0.99
91_Q	94_F	0.730	0.99
45_Y	50_E	0.726	0.99
25_A	62_A	0.726	0.99
70_V	100_I	0.725	0.99
7_I	29_K	0.723	0.99
113_D	116_P	0.723	0.99
124_Y	127_Y	0.716	0.99
18_Y	65_K	0.715	0.99
3_I	93_V	0.706	0.99
73_A	76_A	0.704	0.98
51_I	56_I	0.693	0.98
65_K	68_I	0.693	0.98
3_I	12_D	0.691	0.98
80_R	101_V	0.683	0.98
3_I	29_K	0.683	0.98
65_K	69_A	0.679	0.98
80_R	89_A	0.679	0.98
117_R	124_Y	0.678	0.98
70_V	74_L	0.677	0.98
32_I	101_V	0.664	0.98
48_F	83_T	0.662	0.98
61_T	64_R	0.660	0.98
48_F	81_I	0.654	0.98
58_Y	61_T	0.653	0.98
114_F	120_Q	0.653	0.98
8_V	42_R	0.650	0.97
103_T	107_D	0.643	0.97
71_K	76_A	0.643	0.97
81_I	98_F	0.643	0.97
103_T	106_Q	0.638	0.97
20_N	23_V	0.630	0.97
86_G	89_A	0.625	0.97
63_V	70_V	0.624	0.97
32_I	82_L	0.617	0.97
15_Y	29_K	0.611	0.96
27_L	35_G	0.610	0.96
115_V	120_Q	0.610	0.96
117_R	125_Y	0.605	0.96
114_F	119_E	0.604	0.96
7_I	26_F	0.602	0.96
71_K	86_G	0.601	0.96
48_F	64_R	0.601	0.96
87_K	105_S	0.592	0.96
78_G	89_A	0.588	0.95
74_L	104_W	0.588	0.95
114_F	118_K	0.582	0.95
112_K	118_K	0.582	0.95
59_L	63_V	0.580	0.95
113_D	117_R	0.572	0.95
32_I	92_V	0.562	0.94
69_A	72_K	0.558	0.94
3_I	7_I	0.555	0.94
36_H	99_H	0.551	0.94
28_D	101_V	0.546	0.93
37_T	70_V	0.544	0.93
48_F	56_I	0.544	0.93
16_I	42_R	0.542	0.93
2_C	95_H	0.542	0.93
49_L	68_I	0.540	0.93
10_G	14_G	0.540	0.93
12_D	29_K	0.533	0.93
63_V	67_S	0.528	0.92
4_F	40_V	0.527	0.92
70_V	76_A	0.526	0.92
32_I	111_M	0.525	0.92
109_D	112_K	0.523	0.92
82_L	89_A	0.523	0.92
22_R	43_T	0.519	0.92
17_V	25_A	0.516	0.91
116_P	120_Q	0.516	0.91
67_S	81_I	0.513	0.91
76_A	79_I	0.512	0.91
7_I	40_V	0.511	0.91
57_P	60_C	0.511	0.91
81_I	85_I	0.510	0.91
104_W	107_D	0.509	0.91
37_T	100_I	0.508	0.91
49_L	100_I	0.508	0.91
17_V	27_L	0.506	0.91
60_C	64_R	0.503	0.90
78_G	103_T	0.503	0.90
49_L	67_S	0.500	0.90

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ksvA	2	0.9928	100	0.209	Contact Map
3lb5A	2	0.9496	100	0.239	Contact Map
3l7xA	2	0.9712	100	0.241	Contact Map
2eo4A	2	0.9856	100	0.245	Contact Map
3imiA	2	0.9856	100	0.251	Contact Map
3anoA	4	0.9928	100	0.263	Contact Map
3o0mA	2	0.9424	100	0.265	Contact Map
1y23A	2	1	100	0.266	Contact Map
1emsA	3	0.8849	100	0.285	Contact Map
1fitA	2	0.9065	100	0.294	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.