PGP2 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PGP2 - Phosphoglycolate phosphatase 2

UniProt:	P95931	Sequences: MDIGSNEILVASDYDRTLASEENNFVISPIVSQKVNEFSKKYKFVVVTGREKKFIDKLAVGLKPTAWILENGSLILFNDREFVLCEKSWFERDRKKIIEILDNLKVRYSIGRIILYVDGYGSKLDMLSEIEKYGRIEVNRNDAMILPKGVDKGVGVLKFKELTGFKGKIIALGDSENDYALFRVADIKVAVANAIPQIKEIADIVTENPNGLGVVEILDKILSGNFGKEVDIY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	233 (210)
Sequences:	11992 (9662)
Seq/√Len:	666.8

ECOLI - YBJI YIDA YBHA SUPH MPGP YIGL COF
BACSU - YKRA YITU YCSE YWPJ YHAX NTDB YXEH YWTE
HALSA - PGP
SULSO - PGP2 PGP1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
207_E	216_E	4.003	1.00
21_E	210_N	3.170	1.00
171_A	185_A	2.955	1.00
8_I	168_K	2.825	1.00
208_N	211_G	2.557	1.00
160_K	169_I	2.388	1.00
157_L	184_V	2.371	1.00
182_F	188_K	2.361	1.00
183_R	201_I	2.334	1.00
12_S	44_F	2.281	1.00
30_I	212_L	2.229	1.00
196_P	200_E	2.165	1.00
167_G	184_V	2.122	1.00
20_S	26_V	2.119	1.00
28_S	212_L	2.117	1.00
48_T	55_I	2.115	1.00
30_I	219_D	1.987	1.00
176_E	197_Q	1.947	1.00
151_D	180_A	1.908	1.00
85_C	158_K	1.856	1.00
176_E	195_I	1.847	1.00
158_K	162_L	1.775	1.00
179_Y	198_I	1.728	1.00
38_F	42_Y	1.712	1.00
37_E	219_D	1.710	1.00
39_S	65_T	1.661	1.00
189_V	217_I	1.649	1.00
188_K	203_D	1.646	1.00
11_A	156_V	1.637	1.00
179_Y	201_I	1.636	1.00
7_E	170_I	1.635	1.00
153_G	184_V	1.632	1.00
190_A	202_A	1.631	1.00
90_F	93_D	1.619	1.00
187_I	204_I	1.612	1.00
9_L	45_V	1.604	1.00
158_K	161_E	1.592	1.00
35_V	44_F	1.576	1.00
22_E	26_V	1.573	1.00
29_P	33_Q	1.566	1.00
37_E	40_K	1.563	1.00
187_I	203_D	1.545	1.00
171_A	181_L	1.543	1.00
207_E	211_G	1.532	1.00
32_S	61_G	1.528	1.00
154_V	157_L	1.518	1.00
11_A	47_V	1.513	1.00
77_F	80_R	1.508	1.00
33_Q	37_E	1.480	1.00
43_K	163_T	1.473	1.00
204_I	217_I	1.461	1.00
157_L	161_E	1.449	1.00
14_Y	19_A	1.413	1.00
87_K	158_K	1.408	1.00
91_E	95_K	1.386	1.00
32_S	36_N	1.384	1.00
93_D	96_K	1.383	1.00
179_Y	183_R	1.377	1.00
156_V	181_L	1.359	1.00
7_E	42_Y	1.350	1.00
196_P	199_K	1.346	1.00
30_I	216_E	1.335	1.00
12_S	172_L	1.318	1.00
204_I	221_I	1.314	1.00
160_K	167_G	1.306	1.00
198_I	201_I	1.288	1.00
34_K	215_V	1.287	1.00
172_L	217_I	1.286	1.00
101_L	115_L	1.286	1.00
28_S	31_V	1.281	1.00
7_E	168_K	1.278	1.00
31_V	212_L	1.257	1.00
87_K	147_P	1.255	1.00
172_L	214_V	1.242	1.00
100_I	104_L	1.242	1.00
190_A	194_A	1.237	1.00
197_Q	200_E	1.215	1.00
7_E	187_I	1.205	1.00
214_V	218_L	1.205	1.00
189_V	206_T	1.193	1.00
217_I	221_I	1.191	1.00
34_K	219_D	1.173	1.00
127_L	131_E	1.172	1.00
77_F	81_E	1.171	1.00
199_K	205_V	1.164	1.00
86_E	111_G	1.164	1.00
204_I	220_K	1.162	1.00
215_V	219_D	1.161	1.00
45_V	159_F	1.157	1.00
151_D	154_V	1.149	1.00
30_I	34_K	1.137	1.00
68_I	155_G	1.133	1.00
96_K	133_Y	1.101	1.00
122_S	125_D	1.096	1.00
206_T	217_I	1.096	1.00
36_N	40_K	1.085	1.00
216_E	220_K	1.079	1.00
9_L	165_F	1.076	1.00
192_A	208_N	1.075	1.00
182_F	198_I	1.070	1.00
175_S	195_I	1.065	1.00
104_L	129_E	1.065	1.00
171_A	182_F	1.064	1.00
170_I	221_I	1.060	1.00
217_I	220_K	1.043	1.00
189_V	204_I	1.024	1.00
160_K	184_V	1.022	1.00
20_S	210_N	1.019	1.00
153_G	180_A	1.016	1.00
10_V	42_Y	1.015	1.00
11_A	169_I	1.011	1.00
169_I	185_A	1.011	1.00
36_N	39_S	1.010	1.00
21_E	209_P	1.005	1.00
75_I	158_K	0.995	1.00
159_F	163_T	0.986	1.00
170_I	189_V	0.984	1.00
10_V	38_F	0.976	1.00
75_I	85_C	0.975	1.00
194_A	199_K	0.971	1.00
10_V	218_L	0.968	1.00
14_Y	58_L	0.964	1.00
11_A	45_V	0.963	1.00
206_T	213_G	0.959	1.00
69_L	74_L	0.957	1.00
170_I	217_I	0.957	1.00
96_K	99_E	0.956	1.00
167_G	186_D	0.954	1.00
157_L	167_G	0.952	1.00
73_S	150_V	0.952	1.00
98_I	102_D	0.950	1.00
75_I	155_G	0.949	1.00
87_K	149_G	0.947	1.00
136_I	146_L	0.941	1.00
52_K	69_L	0.940	1.00
9_L	169_I	0.939	1.00
112_R	144_M	0.938	1.00
45_V	66_A	0.935	1.00
47_V	68_I	0.933	1.00
95_K	99_E	0.921	1.00
29_P	32_S	0.915	1.00
124_L	128_S	0.911	1.00
96_K	100_I	0.911	1.00
195_I	198_I	0.902	1.00
170_I	187_I	0.900	1.00
9_L	160_K	0.897	1.00
185_A	188_K	0.895	1.00
18_L	31_V	0.893	1.00
100_I	103_N	0.890	1.00
12_S	214_V	0.889	1.00
192_A	207_E	0.886	1.00
156_V	185_A	0.874	1.00
10_V	170_I	0.871	1.00
193_N	209_P	0.868	1.00
124_L	127_L	0.857	1.00
52_K	76_L	0.857	1.00
191_V	213_G	0.856	1.00
216_E	219_D	0.853	1.00
128_S	131_E	0.853	1.00
176_E	179_Y	0.852	1.00
51_E	70_E	0.852	1.00
33_Q	36_N	0.849	1.00
36_N	63_K	0.844	1.00
192_A	199_K	0.838	1.00
31_V	215_V	0.823	1.00
18_L	35_V	0.823	1.00
69_L	76_L	0.821	1.00
153_G	157_L	0.818	1.00
34_K	37_E	0.817	1.00
147_P	150_V	0.810	1.00
92_R	96_K	0.807	1.00
146_L	151_D	0.806	1.00
30_I	215_V	0.804	1.00
160_K	165_F	0.803	1.00
68_I	159_F	0.800	1.00
31_V	34_K	0.798	1.00
117_V	122_S	0.794	1.00
197_Q	201_I	0.794	1.00
48_T	69_L	0.791	1.00
190_A	198_I	0.790	1.00
131_E	134_G	0.789	1.00
154_V	158_K	0.787	1.00
89_W	147_P	0.781	1.00
99_E	103_N	0.777	1.00
160_K	186_D	0.769	1.00
100_I	129_E	0.767	1.00
186_D	203_D	0.760	1.00
43_K	65_T	0.757	1.00
207_E	213_G	0.751	1.00
191_V	194_A	0.748	1.00
123_K	127_L	0.748	1.00
38_F	44_F	0.746	1.00
125_D	129_E	0.734	1.00
150_V	154_V	0.733	1.00
168_K	186_D	0.729	1.00
12_S	18_L	0.726	1.00
169_I	186_D	0.721	1.00
156_V	171_A	0.721	1.00
52_K	56_D	0.718	1.00
56_D	60_V	0.716	1.00
191_V	206_T	0.714	1.00
104_L	125_D	0.710	1.00
49_G	177_N	0.708	1.00
94_R	98_I	0.703	1.00
157_L	160_K	0.702	1.00
38_F	218_L	0.695	1.00
182_F	201_I	0.694	1.00
88_S	111_G	0.694	1.00
47_V	181_L	0.694	1.00
135_R	145_I	0.693	1.00
103_N	129_E	0.689	1.00
71_N	144_M	0.688	1.00
46_V	55_I	0.686	1.00
78_N	81_E	0.685	1.00
74_L	111_G	0.685	1.00
129_E	133_Y	0.681	1.00
130_I	133_Y	0.680	1.00
55_I	69_L	0.678	1.00
76_L	81_E	0.675	1.00
129_E	132_K	0.673	1.00
7_E	43_K	0.672	1.00
192_A	211_G	0.672	1.00
20_S	28_S	0.672	1.00
169_I	184_V	0.670	1.00
31_V	35_V	0.670	1.00
207_E	220_K	0.669	1.00
22_E	210_N	0.668	1.00
42_Y	170_I	0.668	1.00
117_V	123_K	0.665	1.00
14_Y	46_V	0.664	1.00
18_L	27_I	0.663	1.00
30_I	33_Q	0.663	1.00
206_T	216_E	0.653	1.00
67_W	78_N	0.649	1.00
27_I	32_S	0.646	1.00
14_Y	18_L	0.643	1.00
180_A	183_R	0.636	1.00
14_Y	55_I	0.634	1.00
126_M	130_I	0.632	1.00
114_I	144_M	0.627	1.00
127_L	137_E	0.624	1.00
204_I	216_E	0.622	1.00
8_I	42_Y	0.616	1.00
92_R	95_K	0.614	1.00
75_I	159_F	0.612	1.00
172_L	189_V	0.608	1.00
193_N	208_N	0.607	1.00
34_K	38_F	0.605	1.00
70_E	144_M	0.603	1.00
55_I	67_W	0.603	1.00
84_L	162_L	0.601	1.00
10_V	172_L	0.601	1.00
9_L	159_F	0.598	1.00
194_A	198_I	0.596	1.00
204_I	207_E	0.596	1.00
59_A	67_W	0.596	1.00
149_G	154_V	0.595	1.00
125_D	128_S	0.595	1.00
188_K	198_I	0.595	1.00
124_L	137_E	0.594	1.00
135_R	138_V	0.593	1.00
73_S	147_P	0.592	1.00
174_D	194_A	0.585	1.00
100_I	133_Y	0.585	1.00
27_I	31_V	0.583	1.00
71_N	177_N	0.582	1.00
179_Y	182_F	0.579	1.00
9_L	43_K	0.579	1.00
188_K	202_A	0.577	1.00
198_I	202_A	0.574	1.00
70_E	73_S	0.572	1.00
20_S	209_P	0.566	1.00
51_E	54_F	0.566	1.00
212_L	215_V	0.565	1.00
18_L	214_V	0.563	1.00
193_N	199_K	0.562	1.00
172_L	206_T	0.560	1.00
68_I	75_I	0.560	1.00
182_F	202_A	0.552	1.00
187_I	217_I	0.552	1.00
174_D	191_V	0.552	1.00
192_A	206_T	0.551	1.00
114_I	142_D	0.547	1.00
135_R	143_A	0.547	1.00
59_A	66_A	0.543	1.00
118_D	122_S	0.541	1.00
56_D	59_A	0.541	1.00
139_N	142_D	0.539	1.00
70_E	74_L	0.537	1.00
39_S	63_K	0.536	1.00
46_V	59_A	0.536	1.00
17_T	177_N	0.532	1.00
138_V	144_M	0.527	0.99
99_E	102_D	0.527	0.99
207_E	217_I	0.523	0.99
202_A	205_V	0.523	0.99
100_I	130_I	0.523	0.99
176_E	198_I	0.521	0.99
212_L	216_E	0.518	0.99
70_E	111_G	0.515	0.99
117_V	120_Y	0.515	0.99
77_F	162_L	0.515	0.99
65_T	78_N	0.514	0.99
66_A	163_T	0.513	0.99
18_L	46_V	0.512	0.99
101_L	108_Y	0.512	0.99
190_A	201_I	0.510	0.99
65_T	79_D	0.509	0.99
19_A	209_P	0.509	0.99
66_A	77_F	0.506	0.99
26_V	61_G	0.504	0.99
18_L	209_P	0.504	0.99
39_S	66_A	0.503	0.99
171_A	188_K	0.502	0.99
159_F	162_L	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1nrwA	1	0.9142	100	0.268	Contact Map
2b30A	2	0.9442	100	0.283	Contact Map
3pgvA	3	0.9227	100	0.284	Contact Map
2pq0A	1	0.9227	100	0.295	Contact Map
3l7yA	1	0.9185	100	0.297	Contact Map
1rkqA	1	0.9356	100	0.297	Contact Map
3fzqA	2	0.927	100	0.302	Contact Map
4qjbA	1	0.9442	100	0.302	Contact Map
1rlmA	1	0.9399	100	0.307	Contact Map
3dnpA	2	0.9356	100	0.308	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0088 seconds.