DPS - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DPS - DNA protection during starvation protein

UniProt:	P95855	Sequences: MQEKPQEPKVVGVEILEKSGLDIKKLVDKLVKATAAEFTTYYYYTILRMHLTGMEGEGLKEIAEDARLEDRLHFELMTQRIYELGGGLPRDIRQLADISACSDAYLPENWKDPKEILKVLLEAEQCAIRTWKEVCDMTYGKDPRTYDLAQRILQEEIEHEAWFLELLYGRPSGHFRRSSPGNAPYSKK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	188 (145)
Sequences:	1286 (676)
Seq/√Len:	56.2

ECOLI - BFR
SULSO - DPS

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
76_L	151_R	3.817	1.00
114_K	118_K	3.526	1.00
137_M	140_G	3.048	1.00
118_K	122_E	2.788	1.00
25_K	28_D	2.716	1.00
51_L	116_I	2.599	1.00
23_I	140_G	2.449	1.00
128_I	132_K	2.410	1.00
108_E	122_E	2.282	1.00
112_D	115_E	2.115	1.00
25_K	140_G	2.053	1.00
177_R	182_N	1.988	1.00
69_E	72_L	1.974	1.00
128_I	160_E	1.849	0.99
49_M	75_E	1.810	0.99
61_E	65_D	1.791	0.99
78_T	90_R	1.759	0.99
147_D	150_Q	1.727	0.99
114_K	178_S	1.712	0.99
35_A	39_T	1.701	0.99
114_K	167_L	1.696	0.99
29_K	137_M	1.679	0.99
108_E	126_C	1.644	0.99
31_V	86_G	1.637	0.99
56_G	179_S	1.627	0.99
37_E	156_E	1.562	0.98
41_Y	71_R	1.541	0.98
68_L	71_R	1.527	0.98
53_G	85_G	1.508	0.98
114_K	182_N	1.490	0.98
168_Y	179_S	1.471	0.97
52_T	79_Q	1.463	0.97
81_I	86_G	1.425	0.97
96_A	109_N	1.407	0.96
33_A	131_W	1.405	0.96
26_L	140_G	1.384	0.96
121_L	164_L	1.368	0.96
128_I	156_E	1.345	0.95
161_A	165_E	1.335	0.95
70_D	159_H	1.297	0.94
139_Y	146_Y	1.291	0.94
134_V	149_A	1.268	0.94
36_A	130_T	1.263	0.94
29_K	133_E	1.258	0.93
25_K	137_M	1.229	0.93
34_T	81_I	1.222	0.92
40_T	70_D	1.215	0.92
77_M	148_L	1.214	0.92
127_A	156_E	1.211	0.92
156_E	159_H	1.195	0.92
37_E	73_H	1.194	0.92
32_K	130_T	1.190	0.91
62_I	65_D	1.189	0.91
69_E	155_E	1.183	0.91
77_M	145_T	1.166	0.91
144_R	154_Q	1.144	0.90
45_T	48_R	1.143	0.90
126_C	130_T	1.140	0.90
135_C	149_A	1.128	0.89
29_K	134_V	1.114	0.88
135_C	150_Q	1.075	0.87
26_L	138_T	1.073	0.86
129_R	133_E	1.069	0.86
114_K	183_A	1.062	0.86
47_L	120_L	1.056	0.86
66_A	70_D	1.056	0.86
35_A	94_Q	1.048	0.85
114_K	177_R	1.048	0.85
43_Y	120_L	1.045	0.85
180_P	184_P	1.031	0.84
53_G	83_E	1.030	0.84
95_L	108_E	1.018	0.83
121_L	125_Q	1.016	0.83
70_D	73_H	1.015	0.83
66_A	73_H	1.009	0.83
29_K	130_T	1.008	0.83
139_Y	143_P	1.008	0.83
73_H	159_H	0.999	0.82
51_L	60_K	0.995	0.82
61_E	162_W	0.993	0.82
52_T	64_E	0.993	0.82
112_D	182_N	0.991	0.82
50_H	116_I	0.982	0.81
33_A	130_T	0.975	0.81
64_E	68_L	0.962	0.80
73_H	124_E	0.961	0.80
52_T	60_K	0.959	0.80
24_K	28_D	0.950	0.79
40_T	73_H	0.949	0.79
50_H	110_W	0.944	0.79
69_E	156_E	0.939	0.78
125_Q	160_E	0.936	0.78
110_W	120_L	0.935	0.78
76_L	152_I	0.928	0.77
35_A	116_I	0.926	0.77
73_H	156_E	0.921	0.77
67_R	71_R	0.907	0.76
169_G	180_P	0.905	0.76
45_T	64_E	0.899	0.75
154_Q	157_I	0.896	0.75
48_R	60_K	0.883	0.74
35_A	92_I	0.868	0.72
62_I	162_W	0.865	0.72
77_M	152_I	0.856	0.71
44_Y	124_E	0.855	0.71
37_E	124_E	0.842	0.70
165_E	168_Y	0.838	0.70
60_K	64_E	0.835	0.69
48_R	64_E	0.831	0.69
92_I	95_L	0.828	0.69
45_T	67_R	0.822	0.68
70_D	124_E	0.817	0.68
50_H	82_Y	0.812	0.67
26_L	137_M	0.810	0.67
39_T	94_Q	0.808	0.67
40_T	66_A	0.805	0.67
68_L	72_L	0.802	0.66
69_E	73_H	0.785	0.65
73_H	155_E	0.784	0.65
45_T	82_Y	0.780	0.64
64_E	67_R	0.779	0.64
143_P	146_Y	0.777	0.64
75_E	79_Q	0.776	0.64
80_R	145_T	0.771	0.63
23_I	137_M	0.771	0.63
80_R	142_D	0.768	0.63
133_E	137_M	0.767	0.63
162_W	166_L	0.765	0.63
108_E	119_V	0.763	0.62
37_E	159_H	0.755	0.62
127_A	155_E	0.755	0.62
46_I	87_G	0.749	0.61
63_A	69_E	0.747	0.61
32_K	133_E	0.745	0.61
37_E	127_A	0.740	0.60
89_P	94_Q	0.740	0.60
126_C	156_E	0.738	0.60
132_K	143_P	0.736	0.60
138_T	149_A	0.726	0.59
50_H	54_M	0.720	0.58
133_E	141_K	0.718	0.58
118_K	167_L	0.700	0.56
65_D	69_E	0.696	0.55
135_C	146_Y	0.694	0.55
77_M	149_A	0.690	0.55
73_H	127_A	0.683	0.54
40_T	43_Y	0.679	0.54
37_E	74_F	0.674	0.53
40_T	123_A	0.668	0.52
119_V	122_E	0.663	0.52
62_I	66_A	0.662	0.52
34_T	77_M	0.660	0.52
51_L	113_P	0.659	0.51
136_D	141_K	0.659	0.51
70_D	127_A	0.657	0.51
32_K	35_A	0.656	0.51
36_A	131_W	0.656	0.51
59_L	113_P	0.653	0.51
41_Y	67_R	0.651	0.51
39_T	93_R	0.648	0.50
120_L	163_F	0.646	0.50
36_A	127_A	0.646	0.50
87_G	111_K	0.643	0.50
29_K	140_G	0.640	0.49
68_L	75_E	0.640	0.49
150_Q	154_Q	0.639	0.49
45_T	75_E	0.639	0.49
131_W	156_E	0.635	0.49
83_E	156_E	0.634	0.49
33_A	127_A	0.632	0.49
37_E	44_Y	0.631	0.48
24_K	141_K	0.629	0.48
113_P	182_N	0.620	0.47
110_W	115_E	0.620	0.47
45_T	71_R	0.619	0.47
71_R	93_R	0.618	0.47
125_Q	128_I	0.618	0.47
56_G	113_P	0.615	0.47
128_I	152_I	0.612	0.46
93_R	96_A	0.612	0.46
115_E	157_I	0.611	0.46
33_A	77_M	0.609	0.46
31_V	81_I	0.605	0.46
90_R	96_A	0.604	0.45
135_C	153_L	0.600	0.45
121_L	160_E	0.599	0.45
46_I	109_N	0.590	0.44
92_I	180_P	0.587	0.44
89_P	111_K	0.587	0.44
57_E	61_E	0.582	0.43
127_A	131_W	0.577	0.43
67_R	91_D	0.575	0.42
36_A	66_A	0.571	0.42
27_V	81_I	0.560	0.41
28_D	137_M	0.559	0.41
36_A	152_I	0.558	0.41
70_D	113_P	0.558	0.41
51_L	63_A	0.555	0.40
95_L	119_V	0.552	0.40
32_K	94_Q	0.549	0.40
91_D	111_K	0.549	0.40
144_R	148_L	0.547	0.39
117_L	163_F	0.543	0.39
135_C	139_Y	0.540	0.39
65_D	72_L	0.535	0.38
57_E	150_Q	0.534	0.38
144_R	150_Q	0.531	0.38
31_V	34_T	0.523	0.37
66_A	127_A	0.521	0.37
50_H	109_N	0.515	0.36
123_A	131_W	0.511	0.36
124_E	127_A	0.509	0.36
28_D	32_K	0.508	0.35
42_Y	161_A	0.507	0.35
157_I	161_A	0.506	0.35
147_D	153_L	0.506	0.35
168_Y	178_S	0.505	0.35
72_L	155_E	0.500	0.35

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2clbA	6	0.8989	100	0.481	Contact Map
2v8tA	5	0.9096	100	0.525	Contact Map
2c2uA	6	0.9096	100	0.527	Contact Map
3ak8A	6	0.8138	100	0.534	Contact Map
2c2jA	6	0.867	100	0.536	Contact Map
1o9iA	6	0.8989	100	0.537	Contact Map
4cybA	6	0.8936	100	0.539	Contact Map
2xgwA	6	0.8085	100	0.542	Contact Map
4m32A	6	0.8511	100	0.543	Contact Map
1tjoA	6	0.9309	100	0.543	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.