FLPA - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FLPA - Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase

UniProt:	P58032	Sequences: MSEVITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYKG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	232 (215)
Sequences:	402 (210)
Seq/√Len:	14.3

HALSA - FLPA
SULSO - FLPA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
91_I	106_G	4.304	1.00
163_A	177_M	3.865	1.00
150_L	167_A	3.836	1.00
80_V	94_V	3.302	0.99
94_V	104_A	3.246	0.99
135_R	158_D	3.223	0.98
199_E	202_K	2.984	0.97
158_D	161_D	2.907	0.97
64_A	225_I	2.468	0.92
171_L	175_G	2.423	0.92
132_A	139_S	2.422	0.92
120_V	127_I	2.396	0.91
152_V	163_A	2.375	0.91
200_V	213_I	2.374	0.91
112_R	115_R	2.349	0.90
177_M	228_S	2.278	0.89
62_A	151_Y	2.252	0.88
74_I	149_V	2.249	0.88
178_L	227_L	2.246	0.88
181_I	199_E	2.238	0.88
184_R	222_D	2.213	0.87
64_A	69_L	2.201	0.87
136_F	139_S	2.154	0.86
151_Y	180_V	2.147	0.86
181_I	226_V	2.106	0.85
200_V	226_V	2.099	0.84
85_A	106_G	2.092	0.84
95_S	127_I	2.084	0.84
31_N	43_L	1.907	0.78
183_A	196_Y	1.902	0.78
18_C	28_C	1.883	0.77
35_N	50_E	1.853	0.76
163_A	228_S	1.757	0.72
30_R	49_V	1.751	0.72
187_D	192_P	1.741	0.71
31_N	50_E	1.715	0.70
87_S	186_I	1.682	0.68
74_I	78_T	1.653	0.67
201_E	204_E	1.644	0.67
97_I	186_I	1.640	0.66
28_C	53_E	1.630	0.66
18_C	44_I	1.614	0.65
132_A	216_L	1.599	0.64
34_P	43_L	1.593	0.64
211_I	229_K	1.573	0.63
190_K	194_E	1.524	0.60
196_Y	213_I	1.503	0.59
19_E	23_G	1.499	0.59
110_S	113_V	1.493	0.59
186_I	199_E	1.491	0.59
64_A	163_A	1.463	0.57
106_G	127_I	1.455	0.57
110_S	114_V	1.437	0.56
85_A	91_I	1.422	0.55
161_D	165_Y	1.417	0.55
98_I	104_A	1.401	0.54
28_C	44_I	1.399	0.54
168_K	206_S	1.392	0.53
208_F	228_S	1.390	0.53
201_E	205_N	1.374	0.52
94_V	149_V	1.354	0.51
31_N	35_N	1.351	0.51
91_I	127_I	1.350	0.51
56_A	219_Y	1.332	0.50
43_L	50_E	1.310	0.49
72_N	178_L	1.300	0.48
177_M	226_V	1.294	0.48
218_P	222_D	1.285	0.47
22_D	215_N	1.273	0.47
85_A	117_L	1.267	0.46
156_Q	162_I	1.244	0.45
186_I	202_K	1.243	0.45
86_A	155_A	1.240	0.45
171_L	174_N	1.224	0.44
160_T	181_I	1.206	0.43
158_D	162_I	1.192	0.42
192_P	222_D	1.190	0.42
112_R	116_E	1.178	0.42
52_R	88_G	1.172	0.41
130_L	162_I	1.167	0.41
33_V	104_A	1.155	0.40
38_V	41_E	1.146	0.40
196_Y	224_A	1.129	0.39
86_A	160_T	1.110	0.38
57_F	99_E	1.098	0.37
110_S	120_V	1.094	0.37
216_L	222_D	1.078	0.36
86_A	167_A	1.070	0.36
14_N	99_E	1.069	0.36
77_G	99_E	1.062	0.36
63_G	116_E	1.055	0.35
105_Y	145_E	1.049	0.35
160_T	164_I	1.045	0.35
112_R	181_I	1.044	0.35
112_R	160_T	1.039	0.34
155_A	226_V	1.013	0.33
110_S	213_I	1.004	0.33
64_A	97_I	1.003	0.33
13_E	17_E	1.001	0.33
106_G	117_L	0.992	0.32
37_N	43_L	0.992	0.32
112_R	223_H	0.990	0.32
114_V	131_L	0.982	0.32
64_A	95_S	0.981	0.32
191_D	222_D	0.969	0.31
57_F	67_K	0.968	0.31
147_V	175_G	0.960	0.31
58_R	92_S	0.955	0.30
33_V	127_I	0.955	0.30
15_I	65_I	0.954	0.30
28_C	63_G	0.950	0.30
87_S	102_G	0.945	0.30
33_V	123_R	0.938	0.30
164_I	167_A	0.929	0.29
182_K	223_H	0.924	0.29
82_Y	124_R	0.917	0.29
64_A	177_M	0.911	0.28
216_L	226_V	0.910	0.28
122_Q	139_S	0.905	0.28
84_G	88_G	0.904	0.28
17_E	20_F	0.884	0.27
58_R	89_T	0.882	0.27
32_L	157_P	0.881	0.27
106_G	121_A	0.878	0.27
137_P	175_G	0.874	0.27
205_N	208_F	0.873	0.27
117_L	125_P	0.868	0.27
97_I	214_I	0.868	0.27
168_K	208_F	0.867	0.27
147_V	171_L	0.866	0.26
91_I	190_K	0.865	0.26
37_N	110_S	0.855	0.26
154_I	195_I	0.854	0.26
185_S	223_H	0.853	0.26
15_I	211_I	0.851	0.26
80_V	210_T	0.848	0.26
43_L	117_L	0.842	0.25
59_S	88_G	0.839	0.25
120_V	123_R	0.838	0.25
213_I	226_V	0.836	0.25
80_V	98_I	0.835	0.25
73_P	176_D	0.833	0.25
154_I	220_D	0.832	0.25
81_L	223_H	0.830	0.25
20_F	23_G	0.830	0.25
208_F	229_K	0.829	0.25
74_I	80_V	0.828	0.25
65_I	161_D	0.826	0.25
205_N	229_K	0.826	0.25
150_L	180_V	0.825	0.25
177_M	208_F	0.823	0.25
106_G	217_D	0.819	0.25
96_D	102_G	0.818	0.24
40_G	190_K	0.816	0.24
99_E	152_V	0.816	0.24
118_L	214_I	0.809	0.24
198_T	214_I	0.807	0.24
217_D	226_V	0.806	0.24
15_I	197_K	0.804	0.24
184_R	208_F	0.802	0.24
212_Q	217_D	0.800	0.24
74_I	94_V	0.799	0.24
74_I	225_I	0.798	0.24
40_G	131_L	0.790	0.23
90_T	95_S	0.788	0.23
138_Q	174_N	0.788	0.23
97_I	208_F	0.784	0.23
113_V	220_D	0.782	0.23
129_P	156_Q	0.769	0.23
64_A	220_D	0.766	0.22
61_L	118_L	0.764	0.22
130_L	145_E	0.757	0.22
66_L	219_Y	0.752	0.22
91_I	217_D	0.751	0.22
51_Y	126_N	0.750	0.22
59_S	82_Y	0.743	0.22
150_L	202_K	0.741	0.21
43_L	113_V	0.740	0.21
73_P	78_T	0.740	0.21
80_V	149_V	0.738	0.21
16_Y	100_L	0.724	0.21
52_R	84_G	0.724	0.21
62_A	216_L	0.721	0.21
164_I	206_S	0.719	0.21
62_A	218_P	0.716	0.21
16_Y	46_Y	0.709	0.20
19_E	145_E	0.698	0.20
71_T	108_E	0.698	0.20
208_F	221_K	0.687	0.20
164_I	204_E	0.686	0.20
119_L	191_D	0.685	0.19
84_G	89_T	0.680	0.19
13_E	75_R	0.678	0.19
67_K	218_P	0.674	0.19
195_I	221_K	0.672	0.19
191_D	205_N	0.670	0.19
103_K	128_F	0.670	0.19
19_E	176_D	0.664	0.19
203_L	227_L	0.662	0.19
79_K	120_V	0.661	0.19
77_G	127_I	0.658	0.19
94_V	180_V	0.656	0.18
35_N	135_R	0.654	0.18
85_A	108_E	0.653	0.18
150_L	160_T	0.652	0.18
52_R	59_S	0.652	0.18
114_V	180_V	0.650	0.18
154_I	180_V	0.649	0.18
23_G	26_R	0.648	0.18
183_A	226_V	0.648	0.18
81_L	129_P	0.647	0.18
180_V	225_I	0.645	0.18
121_A	206_S	0.644	0.18
87_S	220_D	0.643	0.18
184_R	192_P	0.643	0.18
169_F	226_V	0.641	0.18
37_N	123_R	0.638	0.18
118_L	132_A	0.638	0.18
144_V	170_F	0.633	0.18
66_L	97_I	0.632	0.18
187_D	195_I	0.629	0.18
89_T	93_H	0.629	0.18
38_V	118_L	0.628	0.18
108_E	170_F	0.627	0.18
156_Q	186_I	0.624	0.17
106_G	161_D	0.621	0.17
65_I	150_L	0.619	0.17
126_N	162_I	0.618	0.17
121_A	219_Y	0.615	0.17
120_V	180_V	0.615	0.17
67_K	214_I	0.615	0.17
20_F	194_E	0.615	0.17
110_S	188_V	0.608	0.17
23_G	139_S	0.608	0.17
51_Y	130_L	0.606	0.17
117_L	142_S	0.605	0.17
82_Y	88_G	0.600	0.17
128_F	138_Q	0.599	0.17
31_N	219_Y	0.599	0.17
204_E	213_I	0.598	0.17
65_I	87_S	0.597	0.17
62_A	201_E	0.596	0.17
126_N	156_Q	0.595	0.17
89_T	155_A	0.591	0.16
139_S	209_E	0.591	0.16
53_E	128_F	0.590	0.16
196_Y	218_P	0.590	0.16
122_Q	155_A	0.589	0.16
110_S	162_I	0.589	0.16
147_V	151_Y	0.587	0.16
116_E	212_Q	0.587	0.16
150_L	201_E	0.585	0.16
212_Q	220_D	0.584	0.16
193_K	206_S	0.584	0.16
90_T	165_Y	0.584	0.16
21_N	205_N	0.580	0.16
87_S	180_V	0.578	0.16
90_T	131_L	0.578	0.16
34_P	50_E	0.577	0.16
34_P	164_I	0.576	0.16
94_V	106_G	0.573	0.16
114_V	142_S	0.573	0.16
143_V	190_K	0.573	0.16
46_Y	144_V	0.572	0.16
180_V	191_D	0.570	0.16
200_V	204_E	0.568	0.16
129_P	166_N	0.567	0.16
103_K	121_A	0.567	0.16
59_S	84_G	0.566	0.16
132_A	142_S	0.565	0.16
122_Q	219_Y	0.564	0.16
40_G	123_R	0.562	0.16
84_G	90_T	0.560	0.16
15_I	170_F	0.558	0.15
51_Y	186_I	0.555	0.15
147_V	172_K	0.553	0.15
31_N	115_R	0.551	0.15
109_F	154_I	0.551	0.15
75_R	197_K	0.550	0.15
64_A	120_V	0.550	0.15
57_F	229_K	0.546	0.15
62_A	208_F	0.545	0.15
36_F	53_E	0.543	0.15
195_I	222_D	0.540	0.15
168_K	204_E	0.540	0.15
95_S	197_K	0.539	0.15
109_F	112_R	0.538	0.15
207_N	217_D	0.538	0.15
217_D	220_D	0.537	0.15
112_R	157_P	0.537	0.15
82_Y	89_T	0.536	0.15
209_E	229_K	0.536	0.15
66_L	110_S	0.536	0.15
72_N	131_L	0.535	0.15
39_Y	166_N	0.534	0.15
203_L	223_H	0.534	0.15
127_I	198_T	0.531	0.15
176_D	211_I	0.530	0.15
176_D	208_F	0.530	0.15
29_T	41_E	0.528	0.15
17_E	66_L	0.526	0.15
202_K	206_S	0.526	0.15
80_V	127_I	0.526	0.15
79_K	139_S	0.525	0.15
146_N	179_L	0.524	0.15
116_E	224_A	0.522	0.14
145_E	197_K	0.522	0.14
21_N	165_Y	0.521	0.14
89_T	182_K	0.519	0.14
119_L	193_K	0.515	0.14
50_E	57_F	0.514	0.14
85_A	121_A	0.513	0.14
41_E	63_G	0.513	0.14
28_C	191_D	0.512	0.14
21_N	117_L	0.511	0.14
23_G	131_L	0.510	0.14
127_I	205_N	0.508	0.14
60_K	63_G	0.506	0.14
30_R	56_A	0.503	0.14
14_N	164_I	0.503	0.14
34_P	38_V	0.502	0.14
121_A	127_I	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3id6C	1	0.9483	100	0.645	Contact Map
2ipxA	1	0.9483	100	0.657	Contact Map
4df3A	1	0.9871	100	0.659	Contact Map
1g8aA	1	0.9784	100	0.676	Contact Map
1fbnA	1	0.9871	100	0.687	Contact Map
1nt2A	2	0.9009	100	0.743	Contact Map
1o54A	4	0.8793	99.2	0.872	Contact Map
1i9gA	3	0.9009	99.1	0.876	Contact Map
2pwyA	3	0.9009	99.1	0.878	Contact Map
4k6mA	2	0.8276	99.1	0.88	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0085 seconds.