RL7A - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL7A - 50S ribosomal protein L7Ae

UniProt:	P55858	Sequences: MSKASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKTSS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	127 (115)
Sequences:	647 (348)
Seq/√Len:	32.5

HALSA - RL7A
SULSO - RL7A

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
53_I	63_V	4.661	1.00
43_V	75_I	3.181	1.00
19_V	114_I	2.870	1.00
53_I	66_L	2.702	1.00
23_V	52_I	2.631	1.00
108_K	112_D	2.377	0.99
16_A	81_S	2.256	0.99
51_V	70_C	2.250	0.99
32_I	56_D	2.159	0.99
51_V	100_A	2.111	0.98
50_L	101_I	2.103	0.98
48_A	100_A	2.027	0.98
46_G	83_K	2.012	0.98
70_C	79_Y	2.004	0.98
40_T	65_H	1.990	0.98
14_D	21_E	1.941	0.97
19_V	52_I	1.914	0.97
24_R	28_E	1.871	0.97
80_V	86_L	1.836	0.96
61_E	64_A	1.797	0.96
18_K	117_R	1.742	0.95
84_K	99_A	1.735	0.95
34_K	38_E	1.569	0.91
56_D	84_K	1.545	0.90
56_D	82_S	1.538	0.90
105_G	111_V	1.531	0.90
20_L	81_S	1.526	0.90
27_K	30_G	1.458	0.88
40_T	69_L	1.437	0.87
11_V	55_E	1.423	0.86
21_E	25_K	1.390	0.85
42_A	100_A	1.363	0.84
37_N	61_E	1.310	0.81
36_T	97_A	1.288	0.80
39_T	51_V	1.281	0.80
107_A	111_V	1.259	0.79
92_L	97_A	1.238	0.78
20_L	90_C	1.229	0.77
114_I	118_V	1.216	0.76
115_I	118_V	1.205	0.76
83_K	98_S	1.196	0.75
23_V	86_L	1.193	0.75
90_C	96_T	1.175	0.74
7_V	10_E	1.169	0.73
36_T	41_K	1.164	0.73
22_A	114_I	1.128	0.71
43_V	73_K	1.125	0.70
71_D	93_Q	1.102	0.69
13_Q	17_D	1.076	0.67
38_E	61_E	1.055	0.65
54_A	83_K	1.046	0.65
32_I	74_K	1.032	0.64
18_K	113_E	1.031	0.63
56_D	87_G	1.028	0.63
112_D	116_K	1.014	0.62
16_A	19_V	0.999	0.61
53_I	64_A	0.994	0.61
38_E	41_K	0.975	0.59
10_E	43_V	0.967	0.58
51_V	72_E	0.964	0.58
46_G	85_A	0.962	0.58
58_Q	110_L	0.934	0.56
107_A	110_L	0.932	0.56
8_K	79_Y	0.925	0.55
18_K	21_E	0.922	0.55
81_S	113_E	0.921	0.55
62_I	90_C	0.914	0.54
50_L	118_V	0.908	0.54
64_A	68_L	0.906	0.54
77_Y	83_K	0.893	0.52
116_K	119_N	0.866	0.50
50_L	89_A	0.859	0.50
42_A	79_Y	0.849	0.49
34_K	98_S	0.848	0.49
99_A	106_E	0.846	0.49
48_A	73_K	0.831	0.47
101_I	113_E	0.824	0.47
88_E	120_E	0.822	0.47
55_E	85_A	0.819	0.46
36_T	65_H	0.819	0.46
26_A	81_S	0.815	0.46
92_L	99_A	0.812	0.46
50_L	104_P	0.807	0.45
51_V	79_Y	0.805	0.45
19_V	28_E	0.798	0.45
23_V	50_L	0.789	0.44
84_K	88_E	0.787	0.44
115_I	119_N	0.786	0.44
14_D	18_K	0.780	0.43
20_L	82_S	0.778	0.43
18_K	68_L	0.766	0.42
72_E	118_V	0.764	0.42
87_G	97_A	0.753	0.41
34_K	96_T	0.752	0.41
33_K	38_E	0.751	0.41
11_V	15_L	0.745	0.40
20_L	66_L	0.738	0.40
66_L	72_E	0.727	0.39
31_K	72_E	0.719	0.38
51_V	102_L	0.718	0.38
68_L	116_K	0.711	0.38
30_G	105_G	0.709	0.38
113_E	120_E	0.701	0.37
36_T	69_L	0.699	0.37
118_V	121_I	0.695	0.36
15_L	101_I	0.693	0.36
32_I	90_C	0.690	0.36
25_K	99_A	0.687	0.36
66_L	73_K	0.686	0.36
23_V	99_A	0.685	0.36
33_K	87_G	0.675	0.35
37_N	40_T	0.672	0.35
17_D	85_A	0.669	0.34
19_V	115_I	0.657	0.34
36_T	43_V	0.650	0.33
74_K	116_K	0.647	0.33
10_E	41_K	0.641	0.32
12_P	46_G	0.641	0.32
17_D	21_E	0.638	0.32
75_I	92_L	0.634	0.32
9_F	55_E	0.632	0.32
12_P	101_I	0.624	0.31
58_Q	61_E	0.619	0.31
40_T	64_A	0.615	0.31
58_Q	117_R	0.607	0.30
58_Q	66_L	0.607	0.30
86_L	96_T	0.606	0.30
39_T	93_Q	0.605	0.30
66_L	86_L	0.599	0.29
8_K	13_Q	0.597	0.29
14_D	77_Y	0.594	0.29
80_V	112_D	0.594	0.29
16_A	78_V	0.589	0.29
71_D	119_N	0.589	0.29
99_A	113_E	0.588	0.29
40_T	91_G	0.582	0.28
110_L	114_I	0.581	0.28
32_I	57_V	0.581	0.28
82_S	108_K	0.580	0.28
19_V	23_V	0.575	0.28
50_L	79_Y	0.574	0.28
24_R	88_E	0.574	0.28
14_D	17_D	0.574	0.28
45_R	69_L	0.569	0.27
20_L	89_A	0.567	0.27
64_A	72_E	0.563	0.27
111_V	115_I	0.562	0.27
111_V	119_N	0.557	0.27
31_K	101_I	0.552	0.26
30_G	85_A	0.552	0.26
90_C	98_S	0.551	0.26
32_I	35_G	0.551	0.26
17_D	24_R	0.548	0.26
56_D	104_P	0.543	0.26
14_D	44_E	0.539	0.26
65_H	77_Y	0.535	0.25
74_K	105_G	0.535	0.25
29_S	43_V	0.533	0.25
28_E	75_I	0.530	0.25
37_N	100_A	0.529	0.25
19_V	78_V	0.528	0.25
33_K	47_Q	0.521	0.24
62_I	70_C	0.521	0.24
75_I	82_S	0.514	0.24
24_R	83_K	0.508	0.24
45_R	87_G	0.507	0.24
58_Q	92_L	0.507	0.24
33_K	102_L	0.505	0.23
61_E	70_C	0.503	0.23
8_K	85_A	0.503	0.23
111_V	118_V	0.502	0.23
79_Y	88_E	0.500	0.23

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3o85A	1	0.9528	100	0.41	Contact Map
4nutA	1	0.9449	100	0.422	Contact Map
2aifA	1	0.8898	100	0.426	Contact Map
2jnbA	1	0.9685	100	0.426	Contact Map
2fc3A	1	0.9764	99.9	0.429	Contact Map
1vq8F	1	0.937	99.9	0.432	Contact Map
1xbiA	1	0.9291	99.9	0.442	Contact Map
4bw0B	1	0.9213	99.9	0.445	Contact Map
3j60M	1	0.8819	99.9	0.458	Contact Map
2lbwA	1	0.8661	99.9	0.463	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.