RS12 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS12 - 30S ribosomal protein S12

UniProt:	P39573	Sequences: MVKSKSPKGIYAARKLRLKRLKFRRSQRKYKTKILKLKEKYDPLGGAPMARGIVLEKVGIESRQPNSAVRKCVRVQLVRNGRVVTAFVPGDGGVNFIDEHDEVIITGIGGTLGRSMGDLPGVRYKVIMVNGVSLDALYKGKKQKPVR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	147 (138)
Sequences:	229 (119)
Seq/√Len:	10.1

HALSA - RS12
SULSO - RS12

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
84_V	105_I	5.153	1.00
58_V	85_T	3.481	0.97
27_Q	30_Y	3.326	0.96
132_V	145_P	3.282	0.96
136_A	141_K	3.175	0.95
72_C	122_V	2.827	0.90
74_R	88_V	2.366	0.80
135_D	139_K	2.301	0.78
34_I	84_V	2.200	0.75
13_A	17_R	1.922	0.64
31_K	35_L	1.877	0.62
100_H	108_I	1.845	0.61
75_V	105_I	1.826	0.60
45_G	51_R	1.790	0.58
90_G	93_G	1.760	0.57
47_A	84_V	1.754	0.57
87_F	91_D	1.750	0.57
44_L	105_I	1.728	0.56
105_I	126_V	1.667	0.53
59_G	69_V	1.598	0.50
55_L	139_K	1.583	0.49
68_A	136_A	1.578	0.49
26_S	38_K	1.568	0.48
34_I	41_Y	1.555	0.48
46_G	52_G	1.545	0.47
44_L	49_M	1.510	0.46
62_S	69_V	1.480	0.44
64_Q	107_G	1.461	0.43
28_R	112_L	1.426	0.42
39_E	42_D	1.421	0.42
21_L	97_I	1.400	0.41
62_S	119_L	1.374	0.40
116_M	119_L	1.368	0.39
86_A	91_D	1.357	0.39
19_K	23_F	1.337	0.38
135_D	141_K	1.325	0.37
63_R	143_Q	1.321	0.37
64_Q	67_S	1.291	0.36
104_I	125_K	1.280	0.36
25_R	31_K	1.265	0.35
41_Y	78_V	1.262	0.35
27_Q	32_T	1.260	0.35
28_R	48_P	1.251	0.34
76_Q	79_R	1.250	0.34
124_Y	135_D	1.230	0.33
119_L	125_K	1.228	0.33
99_E	102_E	1.208	0.33
15_K	96_F	1.195	0.32
83_V	108_I	1.166	0.31
75_V	80_N	1.166	0.31
40_K	99_E	1.132	0.30
21_L	32_T	1.119	0.29
142_K	145_P	1.118	0.29
138_Y	141_K	1.113	0.29
124_Y	128_M	1.107	0.29
23_F	26_S	1.107	0.29
100_H	130_N	1.106	0.29
125_K	139_K	1.098	0.28
81_G	143_Q	1.096	0.28
98_D	116_M	1.077	0.27
76_Q	80_N	1.075	0.27
77_L	80_N	1.043	0.26
60_I	140_G	1.030	0.26
88_V	93_G	1.029	0.26
88_V	94_V	1.026	0.26
123_R	129_V	1.020	0.25
27_Q	49_M	1.018	0.25
13_A	74_R	1.016	0.25
133_S	136_A	1.010	0.25
49_M	63_R	1.008	0.25
81_G	142_K	0.998	0.25
95_N	119_L	0.985	0.24
82_R	111_T	0.978	0.24
74_R	105_I	0.970	0.24
51_R	83_V	0.970	0.24
91_D	117_G	0.970	0.24
98_D	138_Y	0.963	0.23
66_N	118_D	0.958	0.23
116_M	130_N	0.955	0.23
14_R	21_L	0.946	0.23
93_G	138_Y	0.944	0.23
84_V	91_D	0.943	0.23
94_V	98_D	0.941	0.23
83_V	100_H	0.918	0.22
100_H	116_M	0.910	0.22
61_E	64_Q	0.907	0.22
70_R	118_D	0.905	0.22
26_S	29_K	0.899	0.21
10_I	35_L	0.894	0.21
48_P	51_R	0.891	0.21
93_G	143_Q	0.888	0.21
28_R	115_S	0.884	0.21
21_L	124_Y	0.881	0.21
98_D	137_L	0.879	0.21
112_L	115_S	0.874	0.21
137_L	143_Q	0.873	0.21
111_T	123_R	0.870	0.21
52_G	120_P	0.858	0.20
106_T	125_K	0.849	0.20
104_I	108_I	0.847	0.20
49_M	128_M	0.844	0.20
19_K	33_K	0.842	0.20
44_L	126_V	0.841	0.20
75_V	131_G	0.832	0.19
72_C	80_N	0.804	0.19
43_P	82_R	0.792	0.18
45_G	55_L	0.791	0.18
7_P	11_Y	0.790	0.18
30_Y	68_A	0.786	0.18
12_A	33_K	0.774	0.18
60_I	84_V	0.772	0.18
9_G	13_A	0.771	0.18
50_A	89_P	0.769	0.18
76_Q	128_M	0.766	0.18
38_K	42_D	0.763	0.18
46_G	53_I	0.761	0.17
73_V	107_G	0.760	0.17
129_V	134_L	0.758	0.17
21_L	27_Q	0.756	0.17
80_N	123_R	0.752	0.17
62_S	118_D	0.750	0.17
101_D	113_G	0.747	0.17
67_S	107_G	0.745	0.17
128_M	132_V	0.745	0.17
56_E	142_K	0.737	0.17
133_S	140_G	0.736	0.17
109_G	118_D	0.731	0.17
43_P	72_C	0.725	0.17
32_T	83_V	0.724	0.17
96_F	137_L	0.723	0.16
92_G	117_G	0.722	0.16
92_G	95_N	0.722	0.16
53_I	58_V	0.711	0.16
68_A	76_Q	0.710	0.16
20_R	25_R	0.708	0.16
23_F	139_K	0.707	0.16
49_M	106_T	0.702	0.16
43_P	79_R	0.699	0.16
42_D	105_I	0.696	0.16
77_L	121_G	0.693	0.16
9_G	56_E	0.691	0.16
31_K	37_L	0.681	0.15
55_L	74_R	0.677	0.15
52_G	122_V	0.673	0.15
37_L	130_N	0.672	0.15
108_I	141_K	0.667	0.15
13_A	76_Q	0.666	0.15
10_I	37_L	0.664	0.15
93_G	100_H	0.661	0.15
37_L	100_H	0.661	0.15
130_N	140_G	0.654	0.15
61_E	72_C	0.654	0.15
16_L	92_G	0.651	0.15
12_A	18_L	0.651	0.15
82_R	88_V	0.650	0.15
10_I	31_K	0.649	0.15
42_D	114_R	0.642	0.15
62_S	68_A	0.642	0.15
30_Y	62_S	0.641	0.15
63_R	69_V	0.634	0.14
36_K	68_A	0.621	0.14
94_V	97_I	0.621	0.14
38_K	41_Y	0.619	0.14
18_L	95_N	0.619	0.14
9_G	20_R	0.619	0.14
47_A	133_S	0.617	0.14
133_S	142_K	0.616	0.14
11_Y	55_L	0.615	0.14
51_R	78_V	0.601	0.14
73_V	102_E	0.599	0.14
11_Y	48_P	0.599	0.14
45_G	131_G	0.597	0.14
78_V	132_V	0.592	0.13
35_L	53_I	0.591	0.13
93_G	108_I	0.590	0.13
21_L	72_C	0.588	0.13
102_E	113_G	0.583	0.13
37_L	42_D	0.574	0.13
58_V	138_Y	0.567	0.13
37_L	45_G	0.564	0.13
12_A	21_L	0.563	0.13
39_E	45_G	0.560	0.13
54_V	73_V	0.558	0.13
133_S	141_K	0.557	0.13
115_S	126_V	0.555	0.13
93_G	96_F	0.552	0.13
63_R	116_M	0.552	0.13
59_G	132_V	0.549	0.13
18_L	41_Y	0.548	0.13
20_R	54_V	0.546	0.12
16_L	54_V	0.544	0.12
22_K	42_D	0.543	0.12
7_P	10_I	0.542	0.12
44_L	140_G	0.541	0.12
35_L	139_K	0.541	0.12
36_K	97_I	0.537	0.12
10_I	128_M	0.535	0.12
46_G	122_V	0.533	0.12
79_R	82_R	0.527	0.12
44_L	48_P	0.522	0.12
68_A	72_C	0.522	0.12
120_P	145_P	0.519	0.12
62_S	70_R	0.518	0.12
63_R	66_N	0.514	0.12
107_G	134_L	0.507	0.12
27_Q	111_T	0.502	0.12
22_K	29_K	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j20N	1	0.9864	100	0.213	Contact Map
3zeyS	1	0.966	100	0.22	Contact Map
4ujpY	1	0.9796	100	0.224	Contact Map
4bpeL	1	0.9524	100	0.237	Contact Map
5aj3L	1	0.7007	100	0.59	Contact Map
4ji1L	1	0.7755	100	0.596	Contact Map
4rb5L	1	0.7823	100	0.598	Contact Map
2vawA	1	0.3333	9.7	0.967	Contact Map
2vxyA	2	0.2789	8.6	0.968	Contact Map
1ofuA	1	0.2857	8.5	0.968	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.