RS10 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS10 - 30S ribosomal protein S10

UniProt:	P35027	Sequences: MPTKARIRLWSTNVENLNYVITQIRGIVEKTGIEMRGPIPLPTSKLEVPIMRLPHGEGRKKWEKWEMRVHKRLIDIAADERVMRQLMRVRVPEDVYIEIQLI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	102 (98)
Sequences:	1029 (438)
Seq/√Len:	44.2

ECOLI - RS10
BACSU - RS10
HALSA - RS10
SULSO - RS10

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
6_R	75_D	5.660	1.00
49_P	64_K	4.034	1.00
52_R	61_K	3.975	1.00
31_T	82_V	3.920	1.00
46_L	69_V	3.808	1.00
49_P	62_W	2.662	1.00
11_S	17_L	2.660	1.00
51_M	54_P	2.270	1.00
53_L	57_E	2.065	0.99
22_T	26_G	1.973	0.99
51_M	55_H	1.658	0.97
17_L	21_I	1.585	0.96
14_V	18_N	1.553	0.96
53_L	56_G	1.463	0.94
41_L	73_L	1.458	0.94
21_I	36_R	1.441	0.94
51_M	60_K	1.431	0.94
39_I	88_R	1.400	0.93
34_E	77_A	1.364	0.92
92_P	97_I	1.357	0.92
45_K	68_R	1.302	0.90
51_M	61_K	1.286	0.89
7_I	68_R	1.284	0.89
61_K	65_W	1.275	0.89
27_I	30_K	1.274	0.89
51_M	69_V	1.236	0.87
7_I	76_I	1.219	0.87
53_L	59_R	1.210	0.86
39_I	73_L	1.207	0.86
56_G	60_K	1.198	0.86
26_G	30_K	1.195	0.86
46_L	67_M	1.181	0.85
36_R	67_M	1.159	0.84
46_L	49_P	1.145	0.83
23_Q	90_R	1.138	0.83
43_T	70_H	1.120	0.82
53_L	60_K	1.120	0.82
4_K	36_R	1.116	0.81
44_S	71_K	1.114	0.81
4_K	17_L	1.109	0.81
51_M	56_G	1.102	0.81
9_L	17_L	1.088	0.80
39_I	71_K	1.046	0.77
71_K	74_I	1.025	0.76
28_V	74_I	1.018	0.75
8_R	44_S	0.998	0.74
54_P	57_E	0.988	0.73
47_E	64_K	0.986	0.73
11_S	90_R	0.980	0.72
9_L	101_L	0.975	0.72
53_L	61_K	0.974	0.72
46_L	50_I	0.951	0.70
24_I	100_Q	0.946	0.69
25_R	29_E	0.945	0.69
80_E	87_M	0.939	0.69
76_I	82_V	0.934	0.68
44_S	57_E	0.915	0.67
9_L	95_V	0.900	0.66
52_R	65_W	0.864	0.62
3_T	101_L	0.833	0.60
16_N	34_E	0.810	0.57
22_T	79_D	0.804	0.57
96_Y	101_L	0.803	0.57
27_I	87_M	0.802	0.57
46_L	56_G	0.799	0.56
30_K	70_H	0.796	0.56
17_L	20_V	0.792	0.56
27_I	89_V	0.772	0.54
38_P	72_R	0.761	0.53
23_Q	88_R	0.761	0.53
36_R	92_P	0.760	0.53
86_L	100_Q	0.751	0.52
40_P	72_R	0.751	0.52
51_M	62_W	0.750	0.52
31_T	86_L	0.748	0.51
85_Q	88_R	0.747	0.51
56_G	62_W	0.741	0.51
52_R	55_H	0.737	0.50
14_V	70_H	0.736	0.50
48_V	69_V	0.734	0.50
48_V	67_M	0.733	0.50
11_S	44_S	0.733	0.50
26_G	101_L	0.722	0.49
69_V	79_D	0.720	0.49
53_L	66_E	0.712	0.48
16_N	20_V	0.704	0.47
33_I	99_I	0.695	0.46
23_Q	29_E	0.694	0.46
13_N	18_N	0.694	0.46
46_L	71_K	0.691	0.46
8_R	15_E	0.691	0.46
75_D	89_V	0.691	0.46
54_P	87_M	0.689	0.46
12_T	44_S	0.678	0.45
67_M	71_K	0.676	0.45
33_I	82_V	0.674	0.44
87_M	98_E	0.664	0.43
74_I	84_R	0.664	0.43
4_K	73_L	0.662	0.43
17_L	67_M	0.658	0.43
8_R	71_K	0.657	0.43
83_M	87_M	0.656	0.43
18_N	40_P	0.654	0.42
17_L	70_H	0.651	0.42
36_R	74_I	0.643	0.41
57_E	60_K	0.638	0.41
81_R	97_I	0.629	0.40
38_P	42_P	0.626	0.40
17_L	81_R	0.620	0.39
55_H	62_W	0.610	0.38
55_H	59_R	0.604	0.38
33_I	79_D	0.603	0.38
11_S	67_M	0.602	0.38
21_I	25_R	0.601	0.38
74_I	78_A	0.595	0.37
13_N	94_D	0.591	0.37
89_V	100_Q	0.587	0.36
28_V	73_L	0.583	0.36
4_K	101_L	0.570	0.35
13_N	16_N	0.570	0.35
24_I	27_I	0.569	0.35
11_S	15_E	0.568	0.35
19_Y	29_E	0.568	0.35
48_V	56_G	0.568	0.35
15_E	18_N	0.566	0.34
19_Y	96_Y	0.563	0.34
69_V	73_L	0.561	0.34
79_D	95_V	0.556	0.34
43_T	51_M	0.555	0.33
26_G	60_K	0.552	0.33
25_R	35_M	0.546	0.33
22_T	95_V	0.544	0.33
48_V	51_M	0.542	0.32
39_I	75_D	0.537	0.32
49_P	55_H	0.525	0.31
28_V	86_L	0.524	0.31
10_W	98_E	0.523	0.31
35_M	95_V	0.523	0.31
19_Y	23_Q	0.520	0.31
31_T	81_R	0.517	0.30
87_M	97_I	0.514	0.30
50_I	56_G	0.514	0.30
28_V	76_I	0.512	0.30
4_K	75_D	0.510	0.30
26_G	98_E	0.503	0.29
57_E	71_K	0.503	0.29
47_E	68_R	0.500	0.29

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j20L	1	0.9902	100	0.18	Contact Map
3j7aN	1	0.9412	100	0.191	Contact Map
4ujpV	1	1	100	0.196	Contact Map
3j60U	1	1	100	0.196	Contact Map
4bpeJ	1	1	100	0.203	Contact Map
3zeyQ	1	1	100	0.205	Contact Map
3bbnJ	1	0.9608	100	0.21	Contact Map
4w23U	1	1	100	0.214	Contact Map
3w1yC	1	0.8725	100	0.232	Contact Map
4rb5J	1	0.9412	100	0.233	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0125 seconds.