HIS5 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HIS5 - Imidazole glycerol phosphate synthase subunit HisH

UniProt:	O33777	Sequences: MKALVINYGVGNLYSISSALKRVGFEVTIDNKPRNDYDLIVFPGVGAFSAVAEFILRYRELFNDLRRSGTNFLGVCLGMQIMFEKGTEGKESNGLGWFKGIVDKINANVKLPHIGWDLVFEVKDSCELTYGLDKKYVYYVHSYVAYPTSGDYVYMKSQYGIEYPALVCDKNVVGTQFHPEKSSNTGKIFLENLKGWIKR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	199 (191)
Sequences:	3847 (2495)
Seq/√Len:	180.5

ECOLI - HIS5
BACSU - HIS5
HALSA - HIS5
SULSO - HIS5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
4_L	30_D	3.276	1.00
84_E	96_G	3.273	1.00
85_K	101_I	2.948	1.00
157_S	165_A	2.853	1.00
28_T	35_N	2.842	1.00
56_L	59_R	2.735	1.00
126_C	168_C	2.674	1.00
191_E	195_G	2.589	1.00
103_D	146_Y	2.556	1.00
4_L	37_Y	2.391	1.00
32_K	35_N	2.333	1.00
20_L	41_V	2.290	1.00
105_I	163_Y	2.154	1.00
83_F	145_A	2.007	1.00
48_F	94_G	1.973	1.00
84_E	99_K	1.967	1.00
53_E	57_R	1.905	1.00
129_T	166_L	1.891	1.00
139_Y	165_A	1.878	1.00
18_S	21_K	1.856	1.00
119_V	137_V	1.816	1.00
51_V	77_L	1.800	1.00
17_S	21_K	1.782	1.00
83_F	167_V	1.731	1.00
155_M	166_L	1.695	1.00
131_G	192_N	1.671	1.00
54_F	57_R	1.671	1.00
40_I	65_L	1.669	1.00
85_K	91_E	1.657	1.00
158_Q	162_E	1.657	1.00
87_T	103_D	1.655	1.00
188_I	191_E	1.648	1.00
154_Y	168_C	1.643	1.00
135_K	185_T	1.595	1.00
5_V	17_S	1.587	1.00
102_V	145_A	1.582	1.00
153_V	164_P	1.579	1.00
25_F	194_K	1.577	1.00
65_L	70_T	1.576	1.00
137_V	185_T	1.573	1.00
65_L	68_S	1.571	1.00
128_L	173_V	1.565	1.00
156_K	162_E	1.557	1.00
66_R	97_W	1.539	1.00
152_Y	169_D	1.493	1.00
132_L	135_K	1.487	1.00
20_L	25_F	1.476	1.00
144_V	161_I	1.475	1.00
3_A	194_K	1.470	1.00
166_L	175_T	1.470	1.00
109_V	160_G	1.460	1.00
87_T	101_I	1.441	1.00
13_L	29_I	1.420	1.00
82_M	172_V	1.413	1.00
105_I	144_V	1.399	1.00
30_D	35_N	1.387	1.00
17_S	29_I	1.384	1.00
137_V	189_F	1.375	1.00
99_K	152_Y	1.364	1.00
147_P	153_V	1.355	1.00
17_S	27_V	1.327	1.00
84_E	100_G	1.316	1.00
85_K	93_N	1.314	1.00
49_S	90_K	1.311	1.00
113_H	163_Y	1.310	1.00
5_V	20_L	1.309	1.00
103_D	144_V	1.307	1.00
75_V	190_L	1.277	1.00
22_R	187_K	1.272	1.00
30_D	37_Y	1.271	1.00
118_L	134_K	1.270	1.00
98_F	152_Y	1.259	1.00
49_S	89_G	1.256	1.00
87_T	91_E	1.256	1.00
175_T	189_F	1.252	1.00
64_D	68_S	1.251	1.00
119_V	155_M	1.248	1.00
85_K	90_K	1.248	1.00
59_R	63_N	1.243	1.00
127_E	168_C	1.238	1.00
130_Y	195_G	1.219	1.00
58_Y	62_F	1.216	1.00
61_L	65_L	1.215	1.00
49_S	92_S	1.200	1.00
188_I	192_N	1.199	1.00
58_Y	61_L	1.188	1.00
4_L	40_I	1.180	1.00
79_M	174_G	1.176	1.00
21_K	26_E	1.167	1.00
63_N	97_W	1.164	1.00
122_V	156_K	1.145	1.00
82_M	97_W	1.131	1.00
158_Q	161_I	1.116	1.00
131_G	188_I	1.111	1.00
83_F	102_V	1.085	1.00
149_S	152_Y	1.080	1.00
66_R	72_F	1.076	1.00
21_K	27_V	1.071	1.00
24_G	27_V	1.063	1.00
114_I	140_V	1.057	1.00
8_Y	11_G	1.045	1.00
83_F	98_F	1.015	0.99
79_M	145_A	1.011	0.99
84_E	101_I	1.008	0.99
20_L	27_V	1.003	0.99
144_V	164_P	0.994	0.99
14_Y	18_S	0.993	0.99
128_L	192_N	0.987	0.99
83_F	100_G	0.986	0.99
45_V	77_L	0.971	0.99
118_L	136_Y	0.966	0.99
120_F	134_K	0.964	0.99
42_F	72_F	0.964	0.99
119_V	165_A	0.961	0.99
126_C	173_V	0.957	0.99
126_C	154_Y	0.956	0.99
154_Y	166_L	0.953	0.99
101_I	146_Y	0.944	0.99
89_G	92_S	0.936	0.99
73_L	175_T	0.933	0.99
121_E	133_D	0.923	0.99
87_T	104_K	0.903	0.99
132_L	192_N	0.901	0.99
157_S	163_Y	0.900	0.99
168_C	173_V	0.896	0.99
60_E	63_N	0.894	0.99
139_Y	157_S	0.881	0.98
72_F	97_W	0.870	0.98
120_F	158_Q	0.860	0.98
47_A	89_G	0.858	0.98
113_H	141_H	0.853	0.98
5_V	27_V	0.843	0.98
63_N	67_R	0.837	0.98
9_G	54_F	0.835	0.98
39_L	193_L	0.813	0.97
20_L	194_K	0.809	0.97
69_G	170_K	0.806	0.97
48_F	81_I	0.804	0.97
6_I	42_F	0.802	0.97
52_A	56_L	0.798	0.97
59_R	62_F	0.797	0.97
55_I	59_R	0.795	0.97
109_V	159_Y	0.794	0.97
23_V	194_K	0.791	0.97
14_Y	17_S	0.790	0.97
105_I	111_L	0.789	0.97
52_A	92_S	0.789	0.97
93_N	96_G	0.781	0.97
51_V	81_I	0.779	0.97
62_F	97_W	0.776	0.97
20_L	190_L	0.768	0.96
84_E	98_F	0.763	0.96
3_A	39_L	0.762	0.96
98_F	167_V	0.756	0.96
3_A	25_F	0.750	0.96
72_F	82_M	0.748	0.96
7_N	31_N	0.744	0.96
113_H	157_S	0.743	0.96
48_F	92_S	0.742	0.96
106_N	161_I	0.737	0.95
60_E	64_D	0.734	0.95
155_M	165_A	0.732	0.95
113_H	117_D	0.730	0.95
120_F	156_K	0.728	0.95
33_P	61_L	0.726	0.95
119_V	189_F	0.724	0.95
56_L	93_N	0.723	0.95
19_A	23_V	0.723	0.95
33_P	60_E	0.719	0.95
147_P	164_P	0.716	0.95
97_W	172_V	0.713	0.95
45_V	79_M	0.708	0.94
27_V	41_V	0.702	0.94
4_L	28_T	0.700	0.94
66_R	69_G	0.691	0.94
40_I	62_F	0.689	0.93
72_F	172_V	0.686	0.93
10_V	14_Y	0.680	0.93
39_L	71_N	0.673	0.93
52_A	59_R	0.672	0.93
4_L	35_N	0.671	0.93
47_A	90_K	0.670	0.92
62_F	65_L	0.670	0.92
130_Y	188_I	0.663	0.92
125_S	130_Y	0.663	0.92
61_L	66_R	0.661	0.92
64_D	67_R	0.661	0.92
6_I	40_I	0.660	0.92
55_I	58_Y	0.660	0.92
49_S	53_E	0.657	0.92
40_I	68_S	0.657	0.92
8_Y	51_V	0.648	0.91
123_K	151_D	0.647	0.91
23_V	187_K	0.646	0.91
100_G	145_A	0.646	0.91
16_I	75_V	0.645	0.91
114_I	136_Y	0.644	0.91
167_V	174_G	0.642	0.91
47_A	92_S	0.636	0.90
108_N	160_G	0.633	0.90
146_Y	161_I	0.633	0.90
119_V	135_K	0.632	0.90
5_V	29_I	0.627	0.90
121_E	155_M	0.626	0.90
6_I	62_F	0.626	0.90
135_K	188_I	0.625	0.90
99_K	169_D	0.625	0.90
120_F	162_E	0.616	0.89
20_L	23_V	0.614	0.89
120_F	133_D	0.610	0.89
147_P	152_Y	0.609	0.88
122_V	162_E	0.606	0.88
30_D	58_Y	0.605	0.88
146_Y	150_G	0.605	0.88
40_I	61_L	0.605	0.88
53_E	56_L	0.601	0.88
16_I	77_L	0.599	0.88
125_S	154_Y	0.597	0.87
10_V	13_L	0.593	0.87
39_L	183_S	0.592	0.87
104_K	143_Y	0.592	0.87
99_K	149_S	0.589	0.87
69_G	171_N	0.588	0.87
77_L	81_I	0.587	0.87
122_V	125_S	0.586	0.86
16_I	19_A	0.585	0.86
18_S	187_K	0.582	0.86
98_F	172_V	0.577	0.86
55_I	62_F	0.568	0.85
121_E	135_K	0.567	0.85
14_Y	163_Y	0.565	0.84
136_Y	185_T	0.563	0.84
27_V	77_L	0.563	0.84
73_L	193_L	0.559	0.84
40_I	70_T	0.558	0.84
47_A	50_A	0.557	0.84
86_G	105_I	0.557	0.84
56_L	92_S	0.555	0.83
23_V	190_L	0.553	0.83
128_L	189_F	0.551	0.83
51_V	54_F	0.549	0.83
154_Y	173_V	0.548	0.83
117_D	159_Y	0.547	0.83
129_T	155_M	0.546	0.82
16_I	41_V	0.545	0.82
50_A	110_K	0.542	0.82
173_V	193_L	0.540	0.82
10_V	51_V	0.540	0.82
9_G	50_A	0.539	0.82
89_G	143_Y	0.537	0.81
137_V	177_F	0.536	0.81
13_L	110_K	0.536	0.81
127_E	130_Y	0.533	0.81
123_K	126_C	0.533	0.81
15_S	18_S	0.532	0.81
153_V	156_K	0.531	0.81
154_Y	174_G	0.530	0.81
114_I	139_Y	0.528	0.80
42_F	45_V	0.526	0.80
150_G	164_P	0.525	0.80
27_V	194_K	0.525	0.80
145_A	167_V	0.525	0.80
9_G	102_V	0.521	0.79
31_N	54_F	0.521	0.79
132_L	137_V	0.520	0.79
69_G	172_V	0.519	0.79
48_F	86_G	0.518	0.79
52_A	87_T	0.518	0.79
9_G	160_G	0.515	0.79
19_A	187_K	0.514	0.79
32_K	37_Y	0.512	0.78
30_D	61_L	0.509	0.78
48_F	83_F	0.509	0.78
119_V	163_Y	0.509	0.78
14_Y	21_K	0.509	0.78
50_A	54_F	0.508	0.78
58_Y	66_R	0.506	0.77
121_E	125_S	0.506	0.77
86_G	92_S	0.506	0.77
10_V	50_A	0.504	0.77
39_L	173_V	0.504	0.77
5_V	13_L	0.503	0.77
96_G	99_K	0.502	0.77
139_Y	163_Y	0.502	0.77
42_F	81_I	0.500	0.77
100_G	147_P	0.500	0.77

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1jvnA	1	0.9799	100	0.438	Contact Map
4gudA	1	0.9598	100	0.489	Contact Map
1ka9H	1	0.9497	100	0.505	Contact Map
1gpwB	1	0.9497	100	0.516	Contact Map
3uowA	2	0.9447	100	0.532	Contact Map
2v4uA	1	0.9497	100	0.561	Contact Map
2w7tA	1	0.9447	100	0.578	Contact Map
3d54D	1	0.9296	100	0.58	Contact Map
2ywdA	1	0.9196	100	0.581	Contact Map
2issD	1	0.8844	100	0.582	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.