CBP_BcsS - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CBP_BcsS - Cellulose biosynthesis protein BcsS

PFAM:	PF17036	Sequences: QLSADALPGYQFKRGGLEVKLFAGPDYQDHRLSPDDPGNRVRGTEVGLKVAAELWYEPTPRTMLSADASYSTAFDSYWARARLGWRVFDRFYVGPEAAALGDDGYRQWRLGAHLTGLKLGPLEWSLSAGYARDSDGRSGPYGRL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	144 (140)
Sequences:	1291 (1026)
Seq/√Len:	86.7
META:	0.921

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
35_D	42_R	5.053	1.00
77_Y	101_G	4.009	1.00
27_Y	44_T	3.951	1.00
59_T	62_T	3.525	1.00
80_R	96_E	3.255	1.00
84_G	113_H	2.871	1.00
36_D	39_N	2.766	1.00
25_P	46_V	2.573	1.00
26_D	71_S	2.410	1.00
5_D	49_K	2.363	1.00
79_A	99_A	2.295	1.00
39_N	104_G	2.231	1.00
48_L	72_T	2.108	1.00
47_G	72_T	2.015	1.00
13_K	18_E	1.998	1.00
62_T	92_Y	1.948	1.00
21_L	52_A	1.906	1.00
70_Y	75_D	1.762	1.00
63_M	113_H	1.730	1.00
77_Y	99_A	1.659	1.00
84_G	127_S	1.658	1.00
17_L	56_Y	1.656	1.00
22_F	53_E	1.549	1.00
107_Q	131_A	1.491	0.99
58_P	63_M	1.489	0.99
20_K	53_E	1.486	0.99
63_M	92_Y	1.481	0.99
37_P	43_G	1.460	0.99
23_A	48_L	1.450	0.99
107_Q	133_D	1.433	0.99
11_Q	20_K	1.420	0.99
44_T	90_R	1.392	0.99
26_D	73_A	1.353	0.99
67_D	78_W	1.347	0.99
55_W	63_M	1.340	0.99
16_G	60_P	1.332	0.99
130_Y	138_S	1.322	0.99
41_V	102_D	1.308	0.99
32_L	36_D	1.293	0.99
96_E	141_Y	1.291	0.99
27_Y	46_V	1.265	0.98
39_N	43_G	1.251	0.98
51_A	67_D	1.222	0.98
92_Y	113_H	1.217	0.98
30_H	74_F	1.189	0.97
55_W	115_T	1.185	0.97
72_T	75_D	1.177	0.97
45_E	73_A	1.175	0.97
12_F	21_L	1.169	0.97
47_G	71_S	1.164	0.97
97_A	110_L	1.157	0.97
32_L	42_R	1.157	0.97
23_A	50_V	1.151	0.97
57_E	92_Y	1.146	0.97
109_R	127_S	1.126	0.96
63_M	115_T	1.097	0.96
64_L	83_L	1.089	0.96
84_G	115_T	1.082	0.96
64_L	68_A	1.070	0.95
41_V	74_F	1.069	0.95
132_R	135_D	1.053	0.95
78_W	98_A	1.040	0.95
116_G	125_S	1.034	0.94
100_L	105_Y	1.021	0.94
36_D	42_R	1.018	0.94
58_P	62_T	1.016	0.94
28_Q	76_S	1.000	0.93
59_T	92_Y	0.994	0.93
99_A	108_W	0.994	0.93
18_E	53_E	0.992	0.93
89_D	112_A	0.991	0.93
34_P	37_P	0.990	0.93
65_S	80_R	0.988	0.93
58_P	84_G	0.987	0.93
85_W	95_P	0.981	0.93
131_A	139_G	0.975	0.92
11_Q	18_E	0.969	0.92
58_P	92_Y	0.959	0.92
22_F	51_A	0.942	0.91
79_A	101_G	0.940	0.91
19_V	54_L	0.929	0.90
34_P	43_G	0.922	0.90
12_F	17_L	0.922	0.90
97_A	108_W	0.913	0.90
36_D	43_G	0.913	0.90
92_Y	115_T	0.912	0.90
87_V	93_V	0.903	0.89
54_L	66_A	0.886	0.88
12_F	15_G	0.873	0.87
63_M	84_G	0.862	0.87
14_R	17_L	0.859	0.87
101_G	106_R	0.858	0.87
53_E	69_S	0.856	0.86
30_H	43_G	0.850	0.86
68_A	77_Y	0.843	0.86
29_D	50_V	0.836	0.85
30_H	53_E	0.832	0.85
95_P	113_H	0.830	0.85
115_T	125_S	0.818	0.84
48_L	71_S	0.818	0.84
121_P	126_L	0.814	0.84
29_D	44_T	0.813	0.83
45_E	74_F	0.803	0.83
96_E	127_S	0.786	0.81
93_V	138_S	0.777	0.81
132_R	136_G	0.777	0.81
100_L	109_R	0.772	0.80
53_E	56_Y	0.763	0.79
93_V	114_L	0.755	0.79
41_V	103_D	0.754	0.79
97_A	118_K	0.753	0.79
38_G	130_Y	0.752	0.78
36_D	41_V	0.751	0.78
43_G	102_D	0.747	0.78
75_D	105_Y	0.743	0.78
51_A	78_W	0.735	0.77
119_L	122_L	0.733	0.77
57_E	60_P	0.729	0.76
54_L	112_A	0.729	0.76
77_Y	106_R	0.728	0.76
29_D	43_G	0.713	0.75
30_H	39_N	0.713	0.75
56_Y	69_S	0.708	0.74
39_N	45_E	0.707	0.74
26_D	30_H	0.704	0.74
47_G	109_R	0.703	0.74
67_D	92_Y	0.701	0.73
4_A	10_Y	0.701	0.73
51_A	127_S	0.701	0.73
37_P	41_V	0.700	0.73
37_P	53_E	0.696	0.73
5_D	26_D	0.689	0.72
67_D	102_D	0.688	0.72
23_A	82_R	0.684	0.72
30_H	126_L	0.682	0.71
58_P	82_R	0.682	0.71
109_R	113_H	0.671	0.70
7_L	51_A	0.663	0.69
86_R	89_D	0.658	0.69
66_A	81_A	0.657	0.69
15_G	86_R	0.651	0.68
76_S	80_R	0.650	0.68
71_S	76_S	0.641	0.67
58_P	113_H	0.639	0.66
117_L	122_L	0.639	0.66
71_S	116_G	0.634	0.66
62_T	105_Y	0.631	0.65
40_R	83_L	0.625	0.65
39_N	101_G	0.621	0.64
35_D	38_G	0.614	0.63
53_E	109_R	0.614	0.63
8_P	72_T	0.613	0.63
133_D	136_G	0.610	0.63
65_S	86_R	0.595	0.61
111_G	129_G	0.595	0.61
53_E	67_D	0.594	0.61
126_L	129_G	0.593	0.61
114_L	128_A	0.593	0.61
49_K	109_R	0.593	0.61
3_S	30_H	0.593	0.61
31_R	103_D	0.591	0.60
28_Q	71_S	0.588	0.60
117_L	120_G	0.583	0.59
12_F	20_K	0.583	0.59
93_V	112_A	0.581	0.59
31_R	45_E	0.580	0.59
4_A	142_G	0.575	0.58
82_R	125_S	0.574	0.58
19_V	27_Y	0.574	0.58
30_H	41_V	0.573	0.58
6_A	44_T	0.572	0.58
12_F	19_V	0.565	0.57
32_L	39_N	0.565	0.57
118_K	124_W	0.565	0.57
34_P	39_N	0.562	0.57
96_E	111_G	0.561	0.56
114_L	126_L	0.560	0.56
37_P	42_R	0.555	0.56
20_K	54_L	0.555	0.56
58_P	115_T	0.554	0.56
6_A	112_A	0.553	0.55
20_K	67_D	0.553	0.55
9_G	47_G	0.551	0.55
61_R	90_R	0.546	0.54
66_A	100_L	0.544	0.54
47_G	73_A	0.542	0.54
100_L	125_S	0.540	0.54
21_L	107_Q	0.539	0.54
32_L	43_G	0.535	0.53
26_D	63_M	0.534	0.53
34_P	77_Y	0.533	0.53
124_W	142_G	0.532	0.53
36_D	105_Y	0.527	0.52
101_G	105_Y	0.524	0.52
16_G	97_A	0.524	0.52
115_T	118_K	0.521	0.51
88_F	126_L	0.520	0.51
132_R	138_S	0.518	0.51
18_E	92_Y	0.515	0.50
30_H	100_L	0.515	0.50
43_G	123_E	0.515	0.50
34_P	42_R	0.514	0.50
14_R	19_V	0.514	0.50
8_P	110_L	0.514	0.50
32_L	35_D	0.513	0.50
17_L	54_L	0.508	0.49
139_G	142_G	0.506	0.49
71_S	127_S	0.505	0.49
46_V	106_R	0.501	0.48
57_E	86_R	0.500	0.48

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1i78A	2	0.8889	86.3	0.868	Contact Map
4rlcA	1	0.6042	80.1	0.878	Contact Map
1uynX	1	0.8056	76.5	0.881	Contact Map
3kvnX	1	0.9236	73.5	0.884	Contact Map
2x55A	1	0.8472	67.1	0.89	Contact Map
4rl8A	3	0.9792	64.5	0.891	Contact Map
3aehA	1	0.5625	64	0.892	Contact Map
3qraA	1	0.5833	58.4	0.895	Contact Map
3qq2A	2	0.5486	56.9	0.896	Contact Map
3sltA	1	0.6042	56.4	0.897	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.