HisKA_7TM - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HisKA_7TM - N-terminal 7TM region of histidine kinase

PFAM:	PF16927	Sequences: LLLLAALLSLGLALYVWRRRRSPGARAFALLLLAVALWSLGYALELLSTDLETALFWARLQYLGIAFIPVLFLHFALAYTGRRRWLKRRRLALLLIIPALTLLLVLTNPLHGLFYVSSGGFPGLEYEYGPLFWVFLAYSYLLLLAGLVLLIRAYRRSSGLYRRQLKYLLLGALIPLLGNLLYLLGLLPLPGIDLTPLGFLLSGLLLAYAIFRYRLLDIVP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	220 (216)
Sequences:	26298 (23379)
Seq/√Len:	1590.8
META:	0.925

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
37_L	64_G	2.724	1.00
55_L	59_R	2.542	1.00
27_A	74_H	2.532	1.00
34_A	71_L	2.422	1.00
72_F	172_A	2.396	1.00
154_Y	166_K	2.309	1.00
148_V	152_R	2.233	1.00
41_G	57_W	2.184	1.00
27_A	71_L	2.140	1.00
161_Y	164_Q	2.102	1.00
30_L	71_L	2.068	1.00
152_R	156_R	2.029	1.00
50_D	53_T	2.014	1.00
27_A	78_A	2.010	1.00
91_L	95_L	2.001	1.00
179_N	183_L	1.974	1.00
80_T	153_A	1.894	1.00
41_G	60_L	1.888	1.00
72_F	146_G	1.877	1.00
44_L	57_W	1.873	1.00
202_S	206_L	1.866	1.00
32_L	203_G	1.800	1.00
108_N	111_H	1.799	1.00
34_A	67_F	1.789	1.00
76_A	149_L	1.746	1.00
98_P	101_T	1.734	1.00
191_G	195_T	1.719	1.00
185_G	188_P	1.708	1.00
76_A	150_L	1.701	1.00
128_Y	132_F	1.687	1.00
90_R	93_L	1.684	1.00
74_H	78_A	1.682	1.00
138_Y	142_L	1.670	1.00
41_G	64_G	1.668	1.00
163_R	166_K	1.665	1.00
102_L	106_L	1.650	1.00
179_N	182_Y	1.648	1.00
42_Y	46_L	1.634	1.00
101_T	131_L	1.596	1.00
73_L	77_L	1.575	1.00
108_N	112_G	1.562	1.00
42_Y	45_E	1.562	1.00
145_A	149_L	1.551	1.00
73_L	142_L	1.546	1.00
43_A	47_L	1.507	1.00
53_T	57_W	1.505	1.00
67_F	99_A	1.496	1.00
120_G	123_G	1.484	1.00
92_A	95_L	1.461	1.00
76_A	80_T	1.447	1.00
153_A	165_L	1.440	1.00
34_A	64_G	1.434	1.00
70_V	74_H	1.430	1.00
193_D	196_P	1.430	1.00
73_L	145_A	1.417	1.00
207_A	211_F	1.416	1.00
171_G	205_L	1.411	1.00
67_F	71_L	1.404	1.00
144_L	148_V	1.386	1.00
59_R	106_L	1.379	1.00
6_A	43_A	1.365	1.00
178_G	198_G	1.355	1.00
122_P	125_E	1.340	1.00
73_L	149_L	1.325	1.00
178_G	182_Y	1.313	1.00
151_I	155_R	1.295	1.00
175_P	178_G	1.292	1.00
48_S	57_W	1.289	1.00
13_A	17_W	1.281	1.00
76_A	146_G	1.280	1.00
59_R	109_P	1.279	1.00
178_G	183_L	1.273	1.00
135_F	139_S	1.266	1.00
107_T	111_H	1.259	1.00
62_Y	65_I	1.259	1.00
11_G	15_Y	1.255	1.00
29_A	33_L	1.246	1.00
37_L	41_G	1.244	1.00
74_H	95_L	1.241	1.00
109_P	112_G	1.241	1.00
214_R	217_D	1.225	1.00
19_R	25_A	1.211	1.00
61_Q	65_I	1.206	1.00
137_A	141_L	1.200	1.00
87_K	90_R	1.197	1.00
77_L	149_L	1.185	1.00
13_A	32_L	1.184	1.00
121_F	125_E	1.161	1.00
72_F	76_A	1.159	1.00
104_L	131_L	1.159	1.00
41_G	45_E	1.151	1.00
127_E	130_P	1.130	1.00
75_F	79_Y	1.129	1.00
66_A	102_L	1.128	1.00
6_A	36_A	1.125	1.00
208_Y	213_Y	1.121	1.00
59_R	115_Y	1.118	1.00
19_R	22_S	1.117	1.00
147_L	176_L	1.114	1.00
154_Y	165_L	1.109	1.00
131_L	134_V	1.096	1.00
89_R	92_A	1.095	1.00
66_A	135_F	1.092	1.00
81_G	161_Y	1.090	1.00
130_P	133_W	1.090	1.00
140_Y	179_N	1.089	1.00
62_Y	132_F	1.086	1.00
48_S	53_T	1.077	1.00
3_L	43_A	1.075	1.00
10_L	36_A	1.072	1.00
95_L	98_P	1.069	1.00
119_G	122_P	1.066	1.00
160_L	164_Q	1.060	1.00
184_L	188_P	1.057	1.00
6_A	40_L	1.053	1.00
153_A	157_S	1.051	1.00
24_G	78_A	1.041	1.00
13_A	36_A	1.039	1.00
55_L	58_A	1.029	1.00
41_G	61_Q	1.024	1.00
40_L	44_L	1.016	1.00
118_S	121_F	1.011	1.00
129_G	133_W	1.008	1.00
184_L	187_L	1.004	1.00
21_R	24_G	1.002	1.00
56_F	59_R	0.994	1.00
153_A	161_Y	0.994	1.00
71_L	74_H	0.987	1.00
175_P	202_S	0.980	1.00
156_R	159_G	0.978	1.00
97_I	101_T	0.965	1.00
13_A	16_V	0.965	1.00
192_I	195_T	0.960	1.00
110_L	113_L	0.959	1.00
199_F	202_S	0.959	1.00
92_A	96_I	0.954	1.00
116_V	119_G	0.947	1.00
123_G	126_Y	0.945	1.00
12_L	16_V	0.944	1.00
58_A	62_Y	0.939	1.00
101_T	135_F	0.935	1.00
6_A	10_L	0.935	1.00
58_A	61_Q	0.932	1.00
97_I	135_F	0.925	1.00
97_I	100_L	0.921	1.00
152_R	155_R	0.918	1.00
119_G	123_G	0.908	1.00
167_Y	205_L	0.906	1.00
94_L	97_I	0.905	1.00
31_L	71_L	0.904	1.00
33_L	37_L	0.901	1.00
32_L	36_A	0.896	1.00
13_A	29_A	0.893	1.00
209_A	215_L	0.891	1.00
66_A	69_P	0.891	1.00
45_E	61_Q	0.890	1.00
63_L	106_L	0.889	1.00
198_G	202_S	0.887	1.00
29_A	32_L	0.883	1.00
117_S	120_G	0.883	1.00
20_R	23_P	0.880	1.00
157_S	165_L	0.880	1.00
106_L	109_P	0.875	1.00
163_R	167_Y	0.865	1.00
90_R	94_L	0.863	1.00
27_A	31_L	0.857	1.00
202_S	205_L	0.856	1.00
56_F	60_L	0.851	1.00
9_S	203_G	0.850	1.00
167_Y	209_A	0.850	1.00
171_G	206_L	0.849	1.00
121_F	126_Y	0.845	1.00
52_E	55_L	0.844	1.00
80_T	149_L	0.840	1.00
38_W	65_I	0.832	1.00
45_E	58_A	0.826	1.00
82_R	85_W	0.814	1.00
28_F	32_L	0.808	1.00
122_P	126_Y	0.805	1.00
91_L	94_L	0.799	1.00
6_A	9_S	0.798	1.00
83_R	86_L	0.796	1.00
151_I	169_L	0.796	1.00
69_P	146_G	0.795	1.00
139_S	142_L	0.793	1.00
77_L	80_T	0.788	1.00
159_G	163_R	0.785	1.00
5_A	9_S	0.785	1.00
31_L	35_V	0.785	1.00
24_G	27_A	0.785	1.00
70_V	95_L	0.781	1.00
99_A	103_L	0.778	1.00
147_L	172_A	0.778	1.00
23_P	26_R	0.777	1.00
148_V	151_I	0.776	1.00
191_G	196_P	0.775	1.00
198_G	201_L	0.775	1.00
145_A	148_V	0.775	1.00
23_P	27_A	0.774	1.00
160_L	163_R	0.774	1.00
84_R	88_R	0.773	1.00
140_Y	144_L	0.773	1.00
48_S	51_L	0.771	1.00
117_S	122_P	0.770	1.00
199_F	203_G	0.759	1.00
110_L	114_F	0.756	1.00
102_L	105_V	0.753	1.00
154_Y	157_S	0.752	1.00
109_P	113_L	0.750	1.00
22_S	25_A	0.746	1.00
20_R	25_A	0.739	1.00
85_W	89_R	0.738	1.00
100_L	104_L	0.729	1.00
19_R	26_R	0.726	1.00
93_L	96_I	0.725	1.00
25_A	29_A	0.722	1.00
121_F	124_L	0.720	1.00
203_G	207_A	0.719	1.00
85_W	90_R	0.714	1.00
118_S	122_P	0.713	1.00
185_G	189_L	0.705	1.00
28_F	207_A	0.700	1.00
43_A	46_L	0.693	1.00
94_L	98_P	0.693	1.00
50_D	54_A	0.693	1.00
180_L	183_L	0.692	1.00
177_L	180_L	0.692	1.00
194_L	197_L	0.691	1.00
51_L	54_A	0.687	1.00
39_S	45_E	0.686	1.00
141_L	145_A	0.685	1.00
49_T	52_E	0.684	1.00
75_F	168_L	0.679	1.00
146_G	150_L	0.677	1.00
116_V	122_P	0.669	1.00
83_R	87_K	0.668	1.00
97_I	142_L	0.667	1.00
147_L	151_I	0.667	1.00
63_L	67_F	0.663	1.00
26_R	29_A	0.660	1.00
101_T	105_V	0.660	1.00
10_L	14_L	0.658	1.00
192_I	196_P	0.658	1.00
73_L	146_G	0.657	1.00
97_I	138_Y	0.656	1.00
147_L	169_L	0.656	1.00
178_G	181_L	0.654	1.00
116_V	120_G	0.652	1.00
67_F	102_L	0.649	1.00
36_A	40_L	0.649	1.00
9_S	36_A	0.649	1.00
44_L	48_S	0.647	1.00
51_L	55_L	0.647	1.00
67_F	70_V	0.644	1.00
69_P	73_L	0.638	1.00
136_L	140_Y	0.631	1.00
186_L	189_L	0.629	1.00
48_S	54_A	0.626	1.00
187_L	190_P	0.622	1.00
18_R	21_R	0.620	1.00
120_G	124_L	0.619	1.00
89_R	93_L	0.618	1.00
70_V	98_P	0.617	1.00
175_P	179_N	0.617	1.00
166_K	170_L	0.616	1.00
113_L	130_P	0.615	1.00
53_T	56_F	0.614	1.00
136_L	139_S	0.613	1.00
17_W	29_A	0.613	1.00
166_K	169_L	0.612	1.00
98_P	142_L	0.610	1.00
177_L	181_L	0.606	1.00
63_L	102_L	0.604	1.00
27_A	30_L	0.604	1.00
52_E	56_F	0.601	1.00
31_L	68_I	0.601	1.00
129_G	132_F	0.599	1.00
84_R	87_K	0.596	1.00
9_S	13_A	0.589	1.00
208_Y	212_R	0.587	1.00
66_A	101_T	0.585	1.00
201_L	204_L	0.581	1.00
133_W	137_A	0.579	1.00
100_L	103_L	0.578	1.00
61_Q	64_G	0.571	1.00
26_R	30_L	0.566	1.00
39_S	42_Y	0.562	1.00
154_Y	162_R	0.561	1.00
196_P	199_F	0.560	1.00
30_L	34_A	0.557	1.00
117_S	121_F	0.556	1.00
57_W	60_L	0.555	1.00
155_R	158_S	0.551	1.00
98_P	138_Y	0.549	1.00
74_H	96_I	0.549	1.00
159_G	162_R	0.547	1.00
88_R	92_A	0.545	1.00
21_R	26_R	0.543	1.00
85_W	88_R	0.542	1.00
160_L	214_R	0.542	1.00
20_R	26_R	0.541	1.00
196_P	200_L	0.541	1.00
200_L	204_L	0.540	1.00
44_L	47_L	0.537	1.00
45_E	54_A	0.531	1.00
21_R	25_A	0.531	1.00
12_L	207_A	0.529	1.00
7_L	11_G	0.522	1.00
80_T	165_L	0.522	1.00
72_F	202_S	0.521	1.00
190_P	195_T	0.517	1.00
170_L	174_I	0.517	1.00
157_S	161_Y	0.514	1.00
194_L	198_G	0.512	1.00
133_W	136_L	0.511	1.00
205_L	208_Y	0.510	1.00
84_R	90_R	0.509	1.00
171_G	209_A	0.506	1.00
118_S	125_E	0.503	1.00
108_N	113_L	0.503	1.00
130_P	134_V	0.503	1.00
99_A	102_L	0.501	1.00
149_L	153_A	0.501	1.00
45_E	49_T	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ks1B	1	0.1091	5.6	0.927	Contact Map
2l2tA	2	0.1136	5.3	0.928	Contact Map
3wajA	1	0.8091	4.2	0.931	Contact Map
4lz6A	1	0.9591	4.1	0.931	Contact Map
2jwaA	2	0.1045	3.7	0.933	Contact Map
4o6yA	2	0.6727	3.7	0.933	Contact Map
3j1zP	8	0.8727	3.6	0.933	Contact Map
2k1eA	3	0.45	3	0.936	Contact Map
3j2wE	1	0.0909	2.9	0.936	Contact Map
4zwjA	1	0.9909	2.9	0.936	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.