putAbiC - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

putAbiC - Putative phage abortive infection protein

PFAM:	PF16872	Sequences: KHQSDLGHYFRNLYQILKFIDESEEDLSEEEKKKYAKILRAQLSNYELLLLFYNCLSEYGKEKFKPLIEKYNLLKNLPLDDL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	82 (78)
Sequences:	2730 (2438)
Seq/√Len:	276.0
META:	0.85

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
21_D	70_K	4.009	1.00
55_C	68_I	3.258	1.00
17_L	36_A	3.060	1.00
13_L	39_L	2.835	1.00
21_D	71_Y	2.324	1.00
15_Q	37_K	2.016	1.00
12_N	42_Q	1.937	1.00
65_K	69_E	1.910	1.00
68_I	73_L	1.907	1.00
16_I	39_L	1.870	1.00
69_E	72_N	1.794	1.00
68_I	74_L	1.759	1.00
20_I	36_A	1.752	1.00
17_L	73_L	1.726	1.00
17_L	39_L	1.695	1.00
14_Y	54_N	1.654	1.00
3_Q	45_N	1.508	1.00
22_E	34_K	1.506	1.00
46_Y	49_L	1.499	1.00
33_K	72_N	1.490	1.00
11_R	54_N	1.451	1.00
27_L	31_E	1.421	1.00
7_G	11_R	1.376	1.00
9_Y	47_E	1.370	1.00
44_S	47_E	1.361	1.00
2_H	5_D	1.307	1.00
57_S	60_G	1.303	1.00
21_D	67_L	1.259	1.00
49_L	53_Y	1.255	1.00
33_K	37_K	1.230	1.00
28_S	31_E	1.229	1.00
37_K	75_K	1.196	1.00
18_K	37_K	1.187	1.00
40_R	75_K	1.179	1.00
18_K	22_E	1.178	1.00
4_S	46_Y	1.076	1.00
40_R	54_N	1.042	1.00
37_K	40_R	1.018	1.00
49_L	77_L	0.990	1.00
7_G	45_N	0.970	1.00
36_A	71_Y	0.956	1.00
43_L	51_L	0.951	1.00
34_K	38_I	0.943	1.00
10_F	50_L	0.923	1.00
24_E	32_K	0.917	1.00
13_L	51_L	0.899	1.00
20_I	32_K	0.878	1.00
3_Q	78_P	0.877	1.00
21_D	32_K	0.870	1.00
40_R	43_L	0.840	1.00
54_N	76_N	0.831	1.00
17_L	64_F	0.828	1.00
19_F	34_K	0.824	0.99
33_K	36_A	0.816	0.99
12_N	16_I	0.815	0.99
23_S	32_K	0.810	0.99
62_E	66_P	0.800	0.99
15_Q	18_K	0.799	0.99
43_L	47_E	0.798	0.99
12_N	76_N	0.776	0.99
6_L	50_L	0.767	0.99
23_S	27_L	0.742	0.99
10_F	51_L	0.733	0.99
48_L	74_L	0.732	0.99
15_Q	38_I	0.715	0.99
49_L	79_L	0.701	0.98
29_E	33_K	0.700	0.98
15_Q	75_K	0.695	0.98
31_E	34_K	0.670	0.98
23_S	34_K	0.655	0.97
14_Y	40_R	0.653	0.97
14_Y	63_K	0.647	0.97
42_Q	47_E	0.647	0.97
14_Y	18_K	0.647	0.97
60_G	63_K	0.641	0.97
58_E	61_K	0.640	0.97
26_D	29_E	0.631	0.97
22_E	26_D	0.630	0.97
27_L	32_K	0.622	0.97
55_C	64_F	0.620	0.96
23_S	29_E	0.617	0.96
45_N	78_P	0.615	0.96
72_N	75_K	0.608	0.96
20_I	39_L	0.603	0.96
66_P	69_E	0.603	0.96
52_F	75_K	0.602	0.96
17_L	20_I	0.594	0.95
52_F	55_C	0.590	0.95
17_L	67_L	0.589	0.95
56_L	65_K	0.584	0.95
13_L	64_F	0.577	0.95
40_R	76_N	0.571	0.94
11_R	40_R	0.567	0.94
11_R	76_N	0.566	0.94
58_E	79_L	0.559	0.94
19_F	38_I	0.556	0.94
15_Q	41_A	0.552	0.93
22_E	29_E	0.551	0.93
72_N	76_N	0.550	0.93
8_H	44_S	0.549	0.93
6_L	46_Y	0.548	0.93
60_G	66_P	0.547	0.93
52_F	56_L	0.544	0.93
33_K	75_K	0.535	0.92
35_Y	42_Q	0.528	0.92
63_K	75_K	0.527	0.92
49_L	78_P	0.526	0.92
13_L	43_L	0.522	0.91
10_F	54_N	0.520	0.91
61_K	66_P	0.516	0.91
39_L	43_L	0.516	0.91
7_G	10_F	0.509	0.90
61_K	65_K	0.508	0.90
33_K	79_L	0.506	0.90
54_N	60_G	0.502	0.90
59_Y	62_E	0.502	0.90
32_K	71_Y	0.500	0.89

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ykcA	1	0.5732	8	0.867	Contact Map
4j8sA	1	0.7439	6.8	0.871	Contact Map
4b8bA	2	1	6.3	0.873	Contact Map
4w5xB	1	0.7927	3.2	0.889	Contact Map
1x2iA	2	0.5	1.7	0.905	Contact Map
4offA	1	0.3049	1.7	0.905	Contact Map
2kvcA	1	0.7439	1.6	0.906	Contact Map
4tp8M	1	0.5732	1.5	0.908	Contact Map
1a1wA	1	0.6585	1.5	0.908	Contact Map
4kg1A	2	0.1341	1.4	0.909	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.