PhoLip_ATPase_N - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PhoLip_ATPase_N - Phospholipid-translocating ATPase N-terminal

PFAM:	PF16209	Sequences: VVYINDPEENKNKKYPSNKIRTSKYTLLTFLPKNLFEQFRRVANLYFLFIAILQLIPGISPTSPYTT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	67 (59)
Sequences:	3715 (2365)
Seq/√Len:	307.9
META:	0.488

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
39_F	48_L	3.464	1.00
45_L	49_F	2.796	1.00
36_F	40_R	2.509	1.00
34_N	38_Q	2.360	1.00
29_T	32_P	2.235	1.00
54_Q	62_T	2.184	1.00
26_T	29_T	2.143	1.00
28_L	32_P	1.980	1.00
56_I	59_I	1.654	1.00
10_N	13_K	1.637	1.00
37_E	40_R	1.601	1.00
34_N	37_E	1.430	1.00
22_T	43_A	1.411	1.00
21_R	26_T	1.352	1.00
55_L	64_P	1.350	1.00
54_Q	61_P	1.332	1.00
33_K	37_E	1.285	1.00
13_K	16_P	1.243	1.00
19_K	23_S	1.231	1.00
29_T	33_K	1.176	1.00
11_K	14_K	1.175	1.00
52_I	55_L	1.174	1.00
30_F	34_N	1.167	1.00
26_T	32_P	1.160	1.00
34_N	40_R	1.156	1.00
10_N	14_K	1.122	1.00
38_Q	44_N	1.113	1.00
24_K	37_E	1.089	1.00
43_A	53_L	1.063	1.00
46_Y	50_I	1.062	1.00
51_A	62_T	1.050	1.00
38_Q	41_R	1.017	1.00
55_L	60_S	1.017	1.00
8_E	12_N	0.989	1.00
42_V	45_L	0.986	1.00
9_E	12_N	0.939	1.00
45_L	53_L	0.917	1.00
54_Q	57_P	0.915	1.00
9_E	13_K	0.913	1.00
22_T	41_R	0.876	1.00
49_F	53_L	0.876	1.00
61_P	66_T	0.843	1.00
52_I	56_I	0.830	1.00
62_T	66_T	0.826	1.00
22_T	53_L	0.825	1.00
46_Y	66_T	0.814	1.00
34_N	66_T	0.804	1.00
30_F	46_Y	0.796	1.00
43_A	50_I	0.789	1.00
8_E	11_K	0.786	1.00
55_L	59_I	0.740	0.99
21_R	33_K	0.739	0.99
50_I	61_P	0.733	0.99
33_K	64_P	0.701	0.99
32_P	36_F	0.692	0.99
51_A	55_L	0.691	0.99
39_F	42_V	0.681	0.99
53_L	59_I	0.678	0.99
22_T	42_V	0.652	0.98
31_L	34_N	0.651	0.98
22_T	60_S	0.626	0.98
36_F	48_L	0.622	0.98
41_R	61_P	0.614	0.97
8_E	49_F	0.607	0.97
23_S	26_T	0.597	0.97
55_L	58_G	0.590	0.97
37_E	41_R	0.583	0.96
41_R	53_L	0.582	0.96
15_Y	30_F	0.572	0.96
24_K	29_T	0.563	0.96
44_N	56_I	0.562	0.95
51_A	63_S	0.560	0.95
54_Q	60_S	0.556	0.95
62_T	65_Y	0.554	0.95
42_V	46_Y	0.549	0.95
31_L	35_L	0.546	0.95
48_L	52_I	0.544	0.95
50_I	54_Q	0.541	0.94
27_L	32_P	0.540	0.94
63_S	66_T	0.539	0.94
13_K	19_K	0.535	0.94
41_R	45_L	0.527	0.94
10_N	17_S	0.521	0.93
38_Q	61_P	0.517	0.93
43_A	59_I	0.515	0.93
61_P	64_P	0.510	0.93
27_L	41_R	0.510	0.93
13_K	42_V	0.500	0.92

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ar4A	1	0.9403	74.9	0.804	Contact Map
1mhsA	2	0.9403	22.4	0.862	Contact Map
3b8cA	1	0.9403	8.4	0.886	Contact Map
2p8rA	1	0.806	2.5	0.912	Contact Map
2og4A	1	0.806	2	0.916	Contact Map
2qdjA	1	0.8806	1.5	0.922	Contact Map
4i43B	1	0.806	1.4	0.923	Contact Map
3au8A	2	0	1.3	0.924	Contact Map
1r6vA	1	0.4925	1.2	0.926	Contact Map
3ua3A	2	1	1	0.93	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0044 seconds.