Keratin_2_head - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Keratin_2_head - Keratin type II head

PFAM:	PF16208	Sequences: GFSSGSAVVPGGSRSSFSSVSVSRSGGGGGGGGFGGGGGGGGGFGSRSLYNLGGSKRISISVAGGGGRAGSGFGFGGGGGGGFGGGFGGGAGGGFGGGGGFGGGFGGGGGFGGGGGFGGGGFGGGGFGFPVCPPGGIQEVTVNQSLLTPLNLEIDPEIQRV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	161 (153)
Sequences:	732 (419)
Seq/√Len:	33.8
META:	0.007

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
80_G	85_G	3.000	1.00
139_E	144_Q	2.787	1.00
79_G	83_F	2.768	1.00
3_S	6_S	2.729	1.00
5_G	9_V	2.659	1.00
22_V	25_S	2.463	1.00
157_E	160_R	2.341	0.99
45_G	59_S	2.279	0.99
152_L	157_E	2.265	0.99
72_G	79_G	2.252	0.99
16_S	25_S	2.142	0.99
87_F	91_A	2.121	0.99
4_S	10_P	2.082	0.98
141_T	150_L	2.078	0.98
14_R	24_R	2.077	0.98
79_G	82_G	2.077	0.98
83_F	87_F	2.062	0.98
63_A	152_L	2.001	0.98
80_G	83_F	1.983	0.98
103_G	107_G	1.879	0.97
2_F	6_S	1.791	0.96
97_G	101_F	1.780	0.96
85_G	89_G	1.776	0.96
153_E	160_R	1.761	0.96
116_G	120_G	1.680	0.94
135_G	139_E	1.678	0.94
13_S	16_S	1.602	0.93
101_F	107_G	1.592	0.93
148_T	151_N	1.577	0.92
101_F	108_G	1.560	0.92
18_S	22_V	1.529	0.91
136_G	157_E	1.508	0.90
138_Q	141_T	1.486	0.90
1_G	5_G	1.435	0.88
34_F	38_G	1.435	0.88
20_V	23_S	1.433	0.88
26_G	51_N	1.417	0.87
12_G	45_G	1.376	0.86
5_G	8_V	1.370	0.85
51_N	65_G	1.363	0.85
92_G	95_F	1.361	0.85
17_F	22_V	1.334	0.84
141_T	144_Q	1.334	0.84
132_C	135_G	1.333	0.84
76_G	79_G	1.329	0.84
129_F	133_P	1.323	0.83
77_G	80_G	1.321	0.83
82_G	85_G	1.316	0.83
2_F	8_V	1.305	0.83
23_S	26_G	1.276	0.81
106_G	121_G	1.226	0.78
17_F	23_S	1.199	0.77
31_G	35_G	1.193	0.76
12_G	38_G	1.173	0.75
109_G	126_G	1.163	0.75
133_P	157_E	1.152	0.74
10_P	151_N	1.150	0.74
137_I	140_V	1.140	0.73
8_V	11_G	1.131	0.72
151_N	161_V	1.130	0.72
147_L	155_D	1.106	0.71
93_G	97_G	1.102	0.70
122_F	125_G	1.100	0.70
54_G	72_G	1.099	0.70
127_F	131_V	1.090	0.70
4_S	157_E	1.061	0.67
1_G	10_P	1.056	0.67
8_V	16_S	1.055	0.67
133_P	142_V	1.048	0.67
12_G	17_F	1.044	0.66
149_P	155_D	1.034	0.65
81_G	87_F	1.030	0.65
143_N	151_N	1.017	0.64
45_G	56_K	1.010	0.64
138_Q	154_I	1.002	0.63
103_G	109_G	0.994	0.62
120_G	124_G	0.992	0.62
45_G	49_L	0.974	0.61
143_N	150_L	0.974	0.61
146_L	149_P	0.972	0.61
3_S	7_A	0.968	0.60
51_N	160_R	0.967	0.60
140_V	146_L	0.966	0.60
119_G	148_T	0.965	0.60
132_C	136_G	0.955	0.59
14_R	19_S	0.950	0.59
154_I	157_E	0.944	0.58
8_V	15_S	0.941	0.58
13_S	148_T	0.938	0.58
141_T	148_T	0.930	0.57
57_R	64_G	0.927	0.57
21_S	31_G	0.927	0.57
130_P	133_P	0.914	0.56
4_S	9_V	0.903	0.55
4_S	12_G	0.896	0.54
13_S	23_S	0.886	0.53
124_G	154_I	0.884	0.53
2_F	160_R	0.880	0.53
9_V	15_S	0.878	0.53
50_Y	64_G	0.874	0.52
31_G	37_G	0.872	0.52
13_S	18_S	0.869	0.52
80_G	84_G	0.865	0.52
139_E	143_N	0.862	0.51
144_Q	150_L	0.855	0.51
92_G	104_G	0.849	0.50
135_G	158_I	0.845	0.50
146_L	155_D	0.841	0.50
5_G	12_G	0.839	0.50
145_S	151_N	0.830	0.49
115_G	120_G	0.827	0.49
55_S	58_I	0.822	0.48
75_F	79_G	0.818	0.48
103_G	108_G	0.813	0.47
49_L	139_E	0.813	0.47
77_G	83_F	0.813	0.47
17_F	50_Y	0.812	0.47
16_S	142_V	0.807	0.47
144_Q	154_I	0.802	0.46
11_G	28_G	0.799	0.46
37_G	114_G	0.798	0.46
148_T	152_L	0.796	0.46
17_F	152_L	0.794	0.46
129_F	152_L	0.793	0.46
136_G	160_R	0.790	0.45
1_G	9_V	0.789	0.45
127_F	130_P	0.781	0.45
137_I	147_L	0.780	0.45
148_T	160_R	0.777	0.44
32_G	52_L	0.777	0.44
61_S	82_G	0.777	0.44
37_G	40_G	0.776	0.44
98_G	118_G	0.763	0.43
39_G	43_G	0.760	0.43
15_S	157_E	0.756	0.43
83_F	89_G	0.754	0.42
141_T	154_I	0.752	0.42
44_F	158_I	0.751	0.42
1_G	62_V	0.747	0.42
48_S	54_G	0.745	0.42
152_L	160_R	0.743	0.42
2_F	122_F	0.740	0.41
15_S	18_S	0.740	0.41
58_I	138_Q	0.738	0.41
15_S	23_S	0.738	0.41
40_G	151_N	0.736	0.41
122_F	127_F	0.735	0.41
106_G	109_G	0.731	0.41
5_G	10_P	0.724	0.40
147_L	156_P	0.719	0.40
12_G	23_S	0.717	0.39
133_P	160_R	0.715	0.39
19_S	24_R	0.714	0.39
108_G	121_G	0.712	0.39
7_A	14_R	0.707	0.39
40_G	64_G	0.705	0.38
5_G	17_F	0.702	0.38
22_V	41_G	0.702	0.38
8_V	13_S	0.701	0.38
137_I	149_P	0.699	0.38
31_G	34_F	0.697	0.38
77_G	97_G	0.696	0.38
114_G	117_F	0.695	0.38
148_T	161_V	0.690	0.37
73_F	79_G	0.689	0.37
75_F	81_G	0.685	0.37
68_R	97_G	0.683	0.37
87_F	97_G	0.680	0.36
151_N	158_I	0.679	0.36
75_F	78_G	0.678	0.36
141_T	160_R	0.678	0.36
136_G	139_E	0.676	0.36
9_V	13_S	0.675	0.36
2_F	136_G	0.663	0.35
151_N	154_I	0.658	0.35
8_V	12_G	0.653	0.34
9_V	62_V	0.649	0.34
78_G	83_F	0.648	0.34
132_C	160_R	0.643	0.34
55_S	63_A	0.640	0.33
81_G	125_G	0.639	0.33
10_P	157_E	0.639	0.33
9_V	12_G	0.639	0.33
57_R	61_S	0.634	0.33
149_P	156_P	0.633	0.33
16_S	19_S	0.632	0.33
22_V	26_G	0.632	0.33
2_F	55_S	0.631	0.33
46_S	51_N	0.630	0.33
138_Q	160_R	0.624	0.32
140_V	147_L	0.619	0.32
106_G	129_F	0.617	0.32
15_S	22_V	0.615	0.32
85_G	93_G	0.611	0.31
8_V	26_G	0.605	0.31
41_G	143_N	0.604	0.31
28_G	148_T	0.603	0.31
105_F	109_G	0.601	0.31
120_G	128_G	0.598	0.30
94_G	161_V	0.595	0.30
16_S	28_G	0.594	0.30
19_S	25_S	0.591	0.30
42_G	115_G	0.587	0.30
49_L	56_K	0.580	0.29
24_R	41_G	0.579	0.29
137_I	155_D	0.573	0.29
14_R	18_S	0.573	0.29
49_L	135_G	0.572	0.29
34_F	37_G	0.570	0.28
60_I	134_P	0.560	0.28
5_G	13_S	0.557	0.27
38_G	41_G	0.556	0.27
77_G	81_G	0.555	0.27
27_G	144_Q	0.550	0.27
140_V	149_P	0.538	0.26
11_G	15_S	0.533	0.26
101_F	109_G	0.531	0.26
15_S	26_G	0.527	0.26
27_G	128_G	0.526	0.25
130_P	139_E	0.521	0.25
37_G	159_Q	0.521	0.25
95_F	122_F	0.518	0.25
137_I	146_L	0.517	0.25
47_R	56_K	0.516	0.25
89_G	93_G	0.512	0.25
91_A	97_G	0.510	0.24
1_G	11_G	0.507	0.24
54_G	135_G	0.505	0.24
49_L	68_R	0.505	0.24
142_V	145_S	0.500	0.24

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2e7kA	1	0.1925	10.8	0.942	Contact Map
2pjhA	1	0.2298	6.6	0.948	Contact Map
2kelA	2	0.1056	6.3	0.948	Contact Map
1dl6A	1	0.1429	5.3	0.95	Contact Map
3lkxA	1	0.1863	5	0.951	Contact Map
1r6jA	1	0.1801	4.9	0.951	Contact Map
2lnmA	1	0.1615	4.6	0.952	Contact Map
3mcbB	1	0.1863	4.5	0.952	Contact Map
3n44F	1	0.236	4.4	0.952	Contact Map
4uu5A	1	0.205	4.2	0.952	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.