Band_7_C - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Band_7_C - C-terminal region of band_7

PFAM:	PF16200	Sequences: RMVAEAIAQPGGVEAVNLRVAEQYVEAFGKLAKESNTLILPANLSDVAGMIAGAMEVVKAVKK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	63 (59)
Sequences:	8316 (3905)
Seq/√Len:	508.4
META:	0.892

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
7_I	16_V	3.137	1.00
23_Q	26_E	3.113	1.00
43_N	46_D	2.822	1.00
5_E	9_Q	2.615	1.00
27_A	30_K	2.570	1.00
19_R	22_E	2.529	1.00
13_V	17_N	2.212	1.00
26_E	29_G	2.097	1.00
56_E	59_K	1.991	1.00
2_M	5_E	1.883	1.00
30_K	33_K	1.742	1.00
5_E	8_A	1.600	1.00
33_K	36_N	1.410	1.00
31_L	39_I	1.371	1.00
23_Q	27_A	1.272	1.00
40_L	48_A	1.249	1.00
39_I	52_A	1.173	1.00
37_T	40_L	1.162	1.00
25_V	47_V	1.119	1.00
8_A	11_G	1.098	1.00
24_Y	28_F	1.098	1.00
6_A	9_Q	1.066	1.00
53_G	56_E	1.060	1.00
55_M	58_V	1.051	1.00
34_E	37_T	1.041	1.00
8_A	12_G	1.019	1.00
50_M	54_A	1.002	1.00
22_E	26_E	0.959	1.00
31_L	38_L	0.953	1.00
28_F	32_A	0.939	1.00
3_V	19_R	0.933	1.00
48_A	52_A	0.926	1.00
4_A	12_G	0.926	1.00
31_L	37_T	0.912	1.00
41_P	49_G	0.905	1.00
47_V	50_M	0.861	1.00
14_E	17_N	0.843	1.00
35_S	38_L	0.816	1.00
28_F	42_A	0.811	1.00
49_G	52_A	0.805	1.00
8_A	14_E	0.797	1.00
48_A	51_I	0.794	1.00
26_E	30_K	0.794	1.00
30_K	34_E	0.794	1.00
19_R	23_Q	0.788	1.00
16_V	58_V	0.787	1.00
16_V	19_R	0.782	1.00
42_A	50_M	0.766	1.00
44_L	48_A	0.756	1.00
17_N	58_V	0.755	1.00
51_I	54_A	0.749	1.00
2_M	9_Q	0.727	1.00
9_Q	12_G	0.720	1.00
13_V	60_A	0.717	1.00
33_K	37_T	0.714	1.00
55_M	59_K	0.708	1.00
23_Q	29_G	0.672	1.00
56_E	60_A	0.668	1.00
45_S	48_A	0.667	1.00
31_L	34_E	0.666	1.00
3_V	6_A	0.651	1.00
35_S	39_I	0.645	1.00
47_V	51_I	0.643	1.00
44_L	47_V	0.638	1.00
29_G	33_K	0.621	1.00
28_F	40_L	0.619	1.00
43_N	49_G	0.619	1.00
39_I	44_L	0.619	1.00
31_L	40_L	0.616	1.00
20_V	55_M	0.609	1.00
31_L	35_S	0.608	1.00
17_N	24_Y	0.597	0.99
24_Y	44_L	0.588	0.99
11_G	19_R	0.571	0.99
38_L	56_E	0.570	0.99
8_A	13_V	0.568	0.99
57_V	60_A	0.561	0.99
9_Q	13_V	0.548	0.99
44_L	53_G	0.543	0.99
44_L	50_M	0.539	0.99
2_M	6_A	0.534	0.99
24_Y	45_S	0.533	0.99
11_G	15_A	0.514	0.98
50_M	53_G	0.512	0.98
5_E	10_P	0.510	0.98
52_A	55_M	0.508	0.98
52_A	57_V	0.505	0.98
43_N	53_G	0.500	0.98

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4fccA	5	0.7937	10.7	0.851	Contact Map
3aoeE	3	0.7937	10.3	0.852	Contact Map
3mw9A	5	0.7937	10.1	0.853	Contact Map
3r3jA	5	0.7937	9.9	0.853	Contact Map
2bmaA	5	0.7937	9.3	0.855	Contact Map
3aogA	8	0.7937	9.3	0.855	Contact Map
1y4cA	1	0.5238	9.1	0.856	Contact Map
2yfqA	5	0.7937	9	0.856	Contact Map
1bgvA	5	0.7937	8.7	0.857	Contact Map
4xgiA	6	0.7302	8	0.86	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.