PMT_4TMC - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PMT_4TMC - C-terminal four TMM region of protein-O-mannosyltransferase

PFAM:	PF16192	Sequences: FLRSLWEYQKQMYNFHTGLTADTHPYQSPPWSWPLLLRPVWYYYEDDTGAQIYLLGNPLIWWAGLPALLVLLGLLLWRLLRRRRWFDLRAGFILVGYAAGYLPWFLIPRTTFLYHYLPALPFLILALAYVLGRLLRPRRRGRAVVGAYLALVVALFAYFYPILTGLPIPYDAWRARMWLPSW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	182 (177)
Sequences:	8460 (5917)
Seq/√Len:	444.8
META:	0.741

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
64_G	123_L	3.179	1.00
160_Y	164_T	3.116	1.00
172_A	176_R	2.966	1.00
30_P	105_F	2.587	1.00
159_F	178_W	2.520	1.00
7_E	11_Q	2.395	1.00
14_N	18_G	2.370	1.00
56_G	61_W	2.344	1.00
158_Y	176_R	2.292	1.00
10_K	14_N	2.286	1.00
116_Y	119_A	2.281	1.00
93_I	126_A	2.238	1.00
7_E	10_K	2.166	1.00
158_Y	175_A	2.112	1.00
27_Q	110_T	2.043	1.00
32_S	37_L	2.036	1.00
57_N	155_L	2.036	1.00
148_Y	152_V	1.875	1.00
42_Y	54_L	1.822	1.00
59_L	155_L	1.809	1.00
63_A	148_Y	1.788	1.00
155_L	159_F	1.788	1.00
11_Q	14_N	1.774	1.00
60_I	124_I	1.698	1.00
168_I	172_A	1.682	1.00
124_I	128_A	1.658	1.00
81_R	84_R	1.613	1.00
109_R	112_F	1.582	1.00
78_R	84_R	1.571	1.00
13_Y	17_T	1.555	1.00
47_D	50_A	1.550	1.00
5_L	9_Q	1.547	1.00
102_L	105_F	1.544	1.00
23_T	27_Q	1.542	1.00
48_T	51_Q	1.528	1.00
67_A	127_L	1.520	1.00
28_S	40_V	1.505	1.00
63_A	66_P	1.481	1.00
29_P	32_S	1.481	1.00
169_P	172_A	1.471	1.00
173_W	177_M	1.449	1.00
43_Y	165_G	1.445	1.00
60_I	152_V	1.441	1.00
63_A	127_L	1.419	1.00
156_F	163_L	1.415	1.00
78_R	82_R	1.410	1.00
24_H	112_F	1.408	1.00
37_L	179_L	1.351	1.00
59_L	151_L	1.350	1.00
46_D	49_G	1.343	1.00
171_D	174_R	1.313	1.00
4_S	7_E	1.294	1.00
40_V	113_L	1.290	1.00
143_A	146_G	1.287	1.00
68_L	97_Y	1.285	1.00
79_L	82_R	1.282	1.00
80_L	84_R	1.276	1.00
112_F	115_H	1.274	1.00
170_Y	174_R	1.274	1.00
15_F	19_L	1.271	1.00
68_L	126_A	1.267	1.00
6_W	10_K	1.260	1.00
120_L	124_I	1.260	1.00
142_R	146_G	1.258	1.00
90_A	129_Y	1.255	1.00
101_Y	105_F	1.250	1.00
168_I	176_R	1.239	1.00
171_D	175_A	1.231	1.00
97_Y	119_A	1.227	1.00
98_A	102_L	1.220	1.00
85_W	89_R	1.216	1.00
36_L	56_G	1.215	1.00
26_Y	38_R	1.211	1.00
78_R	81_R	1.210	1.00
128_A	132_G	1.203	1.00
77_W	81_R	1.189	1.00
96_G	122_F	1.177	1.00
146_G	150_A	1.175	1.00
145_V	148_Y	1.154	1.00
82_R	85_W	1.152	1.00
47_D	51_Q	1.149	1.00
100_G	119_A	1.144	1.00
175_A	180_P	1.126	1.00
97_Y	101_Y	1.121	1.00
73_G	77_W	1.112	1.00
61_W	113_L	1.107	1.00
59_L	63_A	1.088	1.00
79_L	83_R	1.076	1.00
160_Y	166_L	1.065	1.00
20_T	110_T	1.065	1.00
41_W	53_Y	1.063	1.00
59_L	152_V	1.056	1.00
65_L	123_L	1.045	1.00
65_L	69_L	1.043	1.00
172_A	175_A	1.041	1.00
84_R	89_R	1.031	1.00
97_Y	116_Y	1.016	1.00
37_L	181_S	1.010	1.00
109_R	115_H	1.008	1.00
41_W	44_Y	1.006	1.00
8_Y	11_Q	1.006	1.00
77_W	83_R	1.002	1.00
154_A	157_A	0.996	1.00
79_L	84_R	0.994	1.00
3_R	7_E	0.989	1.00
40_V	54_L	0.986	1.00
74_L	78_R	0.972	1.00
157_A	160_Y	0.966	1.00
135_L	145_V	0.965	1.00
41_W	45_E	0.949	1.00
71_L	75_L	0.943	1.00
20_T	23_T	0.938	1.00
159_F	163_L	0.937	1.00
16_H	19_L	0.934	1.00
67_A	126_A	0.933	1.00
71_L	90_A	0.921	1.00
59_L	148_Y	0.920	1.00
135_L	142_R	0.917	1.00
14_N	17_T	0.915	1.00
34_P	101_Y	0.911	1.00
55_L	159_F	0.910	1.00
95_V	99_A	0.905	1.00
80_L	83_R	0.902	1.00
111_T	115_H	0.880	1.00
131_L	145_V	0.880	1.00
151_L	155_L	0.870	1.00
131_L	148_Y	0.868	1.00
162_I	177_M	0.866	1.00
147_A	151_L	0.864	1.00
108_P	111_T	0.862	1.00
57_N	163_L	0.859	1.00
26_Y	41_W	0.858	1.00
117_L	120_L	0.854	1.00
8_Y	12_M	0.842	1.00
75_L	78_R	0.841	1.00
103_P	106_L	0.839	1.00
90_A	93_I	0.839	1.00
52_I	165_G	0.831	1.00
78_R	83_R	0.830	1.00
36_L	58_P	0.829	1.00
117_L	121_P	0.826	1.00
144_V	147_A	0.822	1.00
115_H	119_A	0.811	1.00
153_V	157_A	0.810	1.00
100_G	104_W	0.806	1.00
73_G	76_L	0.803	1.00
19_L	23_T	0.786	1.00
94_L	98_A	0.784	1.00
56_G	113_L	0.778	1.00
36_L	61_W	0.771	1.00
116_Y	120_L	0.770	1.00
154_A	158_Y	0.769	1.00
115_H	118_P	0.769	1.00
60_I	127_L	0.767	1.00
174_R	177_M	0.765	1.00
152_V	155_L	0.763	1.00
170_Y	173_W	0.755	1.00
129_Y	133_R	0.751	1.00
136_R	139_R	0.751	1.00
102_L	106_L	0.748	1.00
158_Y	172_A	0.747	1.00
75_L	79_L	0.741	1.00
57_N	60_I	0.727	1.00
28_S	32_S	0.722	1.00
71_L	126_A	0.722	1.00
36_L	113_L	0.714	1.00
68_L	98_A	0.711	1.00
93_I	125_L	0.702	1.00
116_Y	123_L	0.700	1.00
92_F	96_G	0.697	1.00
157_A	161_P	0.694	1.00
114_Y	119_A	0.694	1.00
80_L	85_W	0.692	1.00
76_L	80_L	0.690	1.00
116_Y	121_P	0.685	1.00
143_A	147_A	0.678	1.00
3_R	6_W	0.660	1.00
136_R	140_R	0.660	1.00
81_R	85_W	0.658	1.00
72_L	75_L	0.656	1.00
46_D	51_Q	0.656	1.00
162_I	176_R	0.648	0.99
44_Y	53_Y	0.647	0.99
79_L	85_W	0.646	0.99
23_T	110_T	0.645	0.99
174_R	180_P	0.642	0.99
54_L	117_L	0.641	0.99
131_L	149_L	0.638	0.99
162_I	173_W	0.636	0.99
18_G	21_A	0.636	0.99
132_G	135_L	0.635	0.99
96_G	100_G	0.633	0.99
5_L	8_Y	0.633	0.99
70_V	74_L	0.631	0.99
21_A	110_T	0.629	0.99
91_G	95_V	0.629	0.99
115_H	120_L	0.627	0.99
36_L	55_L	0.625	0.99
97_Y	100_G	0.625	0.99
46_D	50_A	0.622	0.99
109_R	114_Y	0.614	0.99
74_L	77_W	0.613	0.99
55_L	113_L	0.610	0.99
104_W	111_T	0.609	0.99
171_D	176_R	0.607	0.99
30_P	101_Y	0.604	0.99
64_G	127_L	0.603	0.99
66_P	69_L	0.602	0.99
110_T	115_H	0.602	0.99
71_L	74_L	0.600	0.99
136_R	141_G	0.597	0.99
4_S	8_Y	0.593	0.99
9_Q	13_Y	0.591	0.99
11_Q	18_G	0.589	0.99
70_V	130_V	0.585	0.99
122_F	129_Y	0.584	0.99
9_Q	15_F	0.584	0.99
29_P	111_T	0.576	0.99
167_P	170_Y	0.568	0.99
55_L	163_L	0.567	0.99
36_L	62_W	0.565	0.99
138_R	141_G	0.565	0.99
100_G	103_P	0.564	0.99
44_Y	49_G	0.564	0.99
43_Y	52_I	0.561	0.99
111_T	114_Y	0.560	0.99
107_I	114_Y	0.559	0.99
156_F	164_T	0.556	0.98
55_L	58_P	0.555	0.98
28_S	33_W	0.554	0.98
12_M	16_H	0.554	0.98
170_Y	177_M	0.553	0.98
60_I	63_A	0.552	0.98
53_Y	162_I	0.550	0.98
121_P	124_I	0.547	0.98
130_V	133_R	0.544	0.98
24_H	38_R	0.541	0.98
103_P	107_I	0.539	0.98
19_L	110_T	0.538	0.98
34_P	123_L	0.536	0.98
56_G	62_W	0.536	0.98
111_T	119_A	0.536	0.98
84_R	90_A	0.532	0.98
93_I	100_G	0.532	0.98
77_W	80_L	0.530	0.98
117_L	123_L	0.530	0.98
104_W	107_I	0.528	0.98
162_I	168_I	0.527	0.98
93_I	129_Y	0.527	0.98
77_W	82_R	0.526	0.98
38_R	181_S	0.525	0.98
26_Y	40_V	0.521	0.98
89_R	92_F	0.521	0.98
109_R	113_L	0.520	0.98
64_G	67_A	0.519	0.98
129_Y	132_G	0.515	0.97
27_Q	108_P	0.514	0.97
6_W	9_Q	0.510	0.97
166_L	169_P	0.508	0.97
26_Y	42_Y	0.506	0.97
145_V	149_L	0.504	0.97
67_A	130_V	0.504	0.97
9_Q	12_M	0.503	0.97
132_G	136_R	0.503	0.97
76_L	84_R	0.501	0.97
143_A	150_A	0.500	0.97

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1jb0I	1	0.2088	5.5	0.946	Contact Map
4l6vi	1	0.2088	5.1	0.947	Contact Map
2ki9A	1	0.1813	3.1	0.953	Contact Map
1lghA	5	0.3077	2	0.957	Contact Map
2k1eA	3	0.544	1.6	0.96	Contact Map
4p02B	1	0.3736	1.5	0.96	Contact Map
2wscI	1	0.1648	1.5	0.96	Contact Map
2ks1B	1	0.2418	1.3	0.961	Contact Map
3lqvP	1	0.0879	1.3	0.962	Contact Map
4jc95	3	0.2308	1	0.964	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.