TIC20 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TIC20 - Chloroplast import apparatus Tic20-like

PFAM:	PF16166	Sequences: PRRRRSSVLPRAASKDVPSSFRYPPMTEKPTWWQRILAALPYLLPLLDGLQFGRFLYFLHPLLEQFPFLQLLLLPLLPLLSLYRSFGGLIIFFALFLGVVRNPKISHFIRFNTMQAILLDIVLILLLLLFILLPLGGLGGLLGETLSNTVFLGVLAAVLYSIVQSLLGRYAEIPTISEAA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	180 (139)
Sequences:	716 (516)
Seq/√Len:	43.8
META:	0.564

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
94_A	98_G	5.339	1.00
41_P	113_T	4.009	1.00
120_D	124_I	3.938	1.00
127_L	131_I	3.105	1.00
89_L	93_F	2.994	1.00
126_L	129_L	2.986	1.00
107_H	170_Y	2.919	1.00
49_G	154_V	2.494	1.00
63_L	67_P	2.418	1.00
109_I	173_I	2.258	1.00
93_F	97_L	2.236	1.00
62_L	69_L	2.150	1.00
67_P	78_P	2.066	0.99
95_L	113_T	2.057	0.99
78_P	83_Y	2.032	0.99
105_I	109_I	2.030	0.99
45_P	116_A	1.880	0.99
112_N	165_S	1.859	0.99
158_V	162_I	1.819	0.98
127_L	134_P	1.799	0.98
74_L	78_P	1.721	0.98
163_V	167_L	1.717	0.98
78_P	82_L	1.704	0.98
138_L	141_L	1.701	0.98
165_S	171_A	1.690	0.97
126_L	130_F	1.675	0.97
63_L	69_L	1.655	0.97
112_N	160_Y	1.612	0.97
41_P	166_L	1.577	0.96
86_F	90_I	1.562	0.96
134_P	138_L	1.526	0.95
127_L	133_L	1.499	0.95
108_F	165_S	1.493	0.95
137_G	140_G	1.489	0.95
72_L	78_P	1.465	0.94
131_I	134_P	1.438	0.94
132_L	137_G	1.358	0.92
120_D	147_S	1.341	0.91
130_F	134_P	1.312	0.90
127_L	130_F	1.268	0.88
48_D	86_F	1.266	0.88
123_L	154_V	1.262	0.88
164_Q	167_L	1.223	0.87
48_D	88_G	1.216	0.86
87_G	90_I	1.205	0.86
134_P	137_G	1.185	0.85
129_L	134_P	1.168	0.84
108_F	170_Y	1.152	0.83
91_I	94_A	1.126	0.82
119_L	157_A	1.124	0.82
131_I	137_G	1.123	0.82
126_L	131_I	1.115	0.81
100_V	113_T	1.105	0.80
161_S	165_S	1.090	0.80
148_N	151_F	1.090	0.80
76_L	87_G	1.088	0.79
133_L	178_E	1.086	0.79
70_Q	81_S	1.072	0.78
67_P	75_P	1.069	0.78
90_I	97_L	1.066	0.78
76_L	83_Y	1.048	0.77
149_T	175_T	1.048	0.77
78_P	84_R	1.002	0.73
107_H	114_M	0.996	0.73
48_D	119_L	0.992	0.73
126_L	132_L	0.991	0.73
48_D	124_I	0.972	0.71
55_F	147_S	0.971	0.71
90_I	93_F	0.967	0.71
52_F	121_I	0.938	0.68
126_L	134_P	0.932	0.68
39_A	161_S	0.916	0.67
41_P	46_L	0.914	0.66
112_N	115_Q	0.910	0.66
43_L	49_G	0.908	0.66
87_G	91_I	0.908	0.66
62_L	65_Q	0.899	0.65
73_L	178_E	0.891	0.64
115_Q	168_G	0.888	0.64
139_G	142_L	0.881	0.64
92_F	97_L	0.874	0.63
123_L	148_N	0.872	0.63
79_L	83_Y	0.868	0.62
37_L	109_I	0.868	0.62
47_L	83_Y	0.864	0.62
39_A	106_S	0.855	0.61
157_A	176_I	0.850	0.61
88_G	132_L	0.842	0.60
80_L	83_Y	0.839	0.60
139_G	152_L	0.838	0.60
44_L	105_I	0.838	0.60
95_L	99_V	0.833	0.59
126_L	133_L	0.829	0.59
101_R	114_M	0.822	0.58
144_E	148_N	0.817	0.58
43_L	118_L	0.817	0.58
162_I	173_I	0.803	0.56
42_Y	97_L	0.802	0.56
134_P	143_G	0.802	0.56
89_L	102_N	0.802	0.56
46_L	122_V	0.799	0.56
100_V	125_L	0.799	0.56
35_R	171_A	0.799	0.56
149_T	153_G	0.798	0.56
96_F	123_L	0.786	0.55
92_F	95_L	0.785	0.55
100_V	114_M	0.776	0.54
146_L	149_T	0.775	0.54
126_L	135_L	0.768	0.53
71_L	77_L	0.756	0.52
168_G	174_P	0.748	0.51
93_F	103_P	0.748	0.51
98_G	113_T	0.743	0.51
35_R	99_V	0.743	0.51
172_E	177_S	0.737	0.50
141_L	145_T	0.732	0.50
127_L	137_G	0.728	0.49
107_H	125_L	0.717	0.48
41_P	107_H	0.711	0.48
37_L	43_L	0.706	0.47
75_P	79_L	0.695	0.46
101_R	172_E	0.679	0.44
68_F	71_L	0.675	0.44
38_A	73_L	0.675	0.44
44_L	88_G	0.668	0.43
96_F	100_V	0.664	0.43
125_L	169_R	0.660	0.43
63_L	126_L	0.660	0.43
66_F	119_L	0.658	0.43
64_E	166_L	0.653	0.42
53_G	177_S	0.653	0.42
43_L	120_D	0.648	0.42
63_L	85_S	0.645	0.41
35_R	101_R	0.644	0.41
108_F	118_L	0.642	0.41
131_I	147_S	0.641	0.41
86_F	92_F	0.640	0.41
109_I	175_T	0.639	0.41
50_L	84_R	0.638	0.41
129_L	133_L	0.632	0.40
70_Q	84_R	0.628	0.40
134_P	140_G	0.628	0.40
62_L	67_P	0.627	0.40
46_L	177_S	0.620	0.39
47_L	88_G	0.617	0.39
62_L	132_L	0.617	0.39
144_E	176_I	0.614	0.38
65_Q	161_S	0.612	0.38
158_V	161_S	0.612	0.38
43_L	122_V	0.610	0.38
64_E	89_L	0.602	0.37
120_D	169_R	0.594	0.37
116_A	120_D	0.592	0.36
44_L	120_D	0.588	0.36
88_G	114_M	0.587	0.36
45_P	120_D	0.584	0.36
37_L	170_Y	0.583	0.36
144_E	156_A	0.582	0.36
127_L	132_L	0.581	0.35
103_P	111_F	0.578	0.35
168_G	173_I	0.577	0.35
48_D	143_G	0.577	0.35
54_R	80_L	0.576	0.35
46_L	118_L	0.576	0.35
164_Q	177_S	0.576	0.35
153_G	164_Q	0.575	0.35
102_N	125_L	0.574	0.35
87_G	96_F	0.572	0.35
48_D	164_Q	0.572	0.35
119_L	124_I	0.570	0.35
164_Q	172_E	0.568	0.34
130_F	176_I	0.565	0.34
130_F	133_L	0.561	0.34
149_T	154_V	0.561	0.34
99_V	102_N	0.560	0.34
76_L	82_L	0.560	0.34
38_A	47_L	0.559	0.34
135_L	146_L	0.553	0.33
153_G	159_L	0.552	0.33
46_L	124_I	0.549	0.33
145_T	149_T	0.547	0.33
65_Q	68_F	0.542	0.32
50_L	54_R	0.540	0.32
117_I	148_N	0.540	0.32
122_V	161_S	0.539	0.32
48_D	87_G	0.539	0.32
63_L	80_L	0.532	0.31
164_Q	175_T	0.532	0.31
137_G	141_L	0.532	0.31
143_G	150_V	0.529	0.31
119_L	133_L	0.528	0.31
36_I	133_L	0.528	0.31
44_L	96_F	0.525	0.31
63_L	82_L	0.525	0.31
43_L	162_I	0.523	0.31
73_L	79_L	0.523	0.31
135_L	161_S	0.520	0.30
79_L	84_R	0.519	0.30
130_F	169_R	0.518	0.30
47_L	79_L	0.511	0.30
118_L	171_A	0.507	0.29
163_V	166_L	0.507	0.29
90_I	165_S	0.507	0.29
66_F	69_L	0.506	0.29
152_L	171_A	0.503	0.29
39_A	49_G	0.503	0.29
48_D	54_R	0.500	0.29
45_P	160_Y	0.500	0.29

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3s8fA	1	0.3333	11.3	0.945	Contact Map
4quvA	2	0.6944	8.5	0.948	Contact Map
3mi9C	1	0	8.1	0.949	Contact Map
1tacA	1	0.1944	7.4	0.95	Contact Map
3c5xC	1	0	7	0.95	Contact Map
1vzmA	1	0.2333	2.2	0.961	Contact Map
4b03D	5	0.3889	1.6	0.964	Contact Map
5aftc	1	0.0889	1.1	0.967	Contact Map
3ukwC	1	0.1222	1.1	0.967	Contact Map
3aa1C	1	0.05	1.1	0.967	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.