Jas - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Jas - TPL-binding domain in jasmonate signalling

PFAM:	PF16135	Sequences: YHGKRTVLSWLIFDNGGLLDGAKVKYRNRGGKKLLEGYITGDGILCSCCNKVLSPSEFEAHAGSKRRRPYRHIY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	74 (70)
Sequences:	649 (359)
Seq/√Len:	42.9
META:	0.085

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
24_V	39_I	3.399	1.00
35_L	53_L	2.841	1.00
16_G	22_A	2.093	0.99
63_G	69_P	2.084	0.99
20_D	45_L	1.995	0.99
7_V	10_W	1.956	0.99
14_D	41_G	1.944	0.99
59_E	73_I	1.936	0.99
59_E	67_R	1.917	0.99
4_K	35_L	1.882	0.99
19_L	22_A	1.795	0.98
24_V	59_E	1.736	0.98
11_L	68_R	1.709	0.97
54_S	60_A	1.683	0.97
56_S	66_R	1.632	0.97
31_G	53_L	1.571	0.96
59_E	64_S	1.467	0.94
26_Y	59_E	1.420	0.93
66_R	72_H	1.363	0.91
29_R	50_N	1.352	0.91
37_G	49_C	1.309	0.89
5_R	9_S	1.300	0.89
42_D	69_P	1.234	0.86
38_Y	42_D	1.222	0.86
11_L	15_N	1.219	0.86
12_I	43_G	1.216	0.86
27_R	35_L	1.178	0.84
53_L	74_Y	1.101	0.79
23_K	36_E	1.094	0.79
31_G	35_L	1.083	0.78
4_K	33_K	1.064	0.77
24_V	71_R	1.041	0.75
50_N	67_R	1.024	0.74
29_R	44_I	1.022	0.74
28_N	31_G	1.001	0.73
4_K	15_N	1.000	0.72
6_T	11_L	0.993	0.72
64_S	71_R	0.963	0.70
71_R	74_Y	0.959	0.69
18_L	53_L	0.954	0.69
64_S	69_P	0.945	0.68
19_L	70_Y	0.928	0.67
33_K	54_S	0.922	0.66
26_Y	62_A	0.919	0.66
55_P	70_Y	0.910	0.65
27_R	32_K	0.906	0.65
64_S	70_Y	0.902	0.64
8_L	54_S	0.894	0.64
21_G	45_L	0.875	0.62
29_R	67_R	0.873	0.62
44_I	54_S	0.871	0.62
24_V	62_A	0.861	0.61
30_G	33_K	0.860	0.61
15_N	67_R	0.859	0.61
28_N	66_R	0.858	0.61
28_N	65_K	0.850	0.60
49_C	52_V	0.835	0.58
17_G	39_I	0.793	0.55
43_G	52_V	0.792	0.54
9_S	17_G	0.773	0.53
37_G	43_G	0.770	0.52
53_L	63_G	0.746	0.50
10_W	55_P	0.738	0.49
66_R	70_Y	0.727	0.48
23_K	40_T	0.723	0.48
30_G	63_G	0.717	0.47
22_A	64_S	0.716	0.47
32_K	74_Y	0.701	0.46
46_C	61_H	0.701	0.46
29_R	35_L	0.695	0.45
17_G	20_D	0.685	0.44
70_Y	73_I	0.674	0.43
16_G	72_H	0.668	0.43
4_K	53_L	0.668	0.43
19_L	59_E	0.655	0.42
19_L	53_L	0.655	0.42
21_G	53_L	0.654	0.41
11_L	43_G	0.645	0.41
32_K	36_E	0.639	0.40
64_S	67_R	0.636	0.40
41_G	51_K	0.633	0.40
37_G	59_E	0.630	0.39
53_L	72_H	0.626	0.39
60_A	67_R	0.620	0.38
30_G	36_E	0.616	0.38
47_S	52_V	0.611	0.38
36_E	52_V	0.598	0.36
68_R	71_R	0.596	0.36
50_N	60_A	0.583	0.35
5_R	15_N	0.568	0.34
38_Y	57_E	0.565	0.34
40_T	51_K	0.558	0.33
18_L	23_K	0.554	0.33
63_G	66_R	0.546	0.32
21_G	33_K	0.540	0.31
4_K	14_D	0.537	0.31
38_Y	67_R	0.532	0.31
64_S	72_H	0.527	0.30
29_R	65_K	0.523	0.30
40_T	69_P	0.519	0.30
14_D	37_G	0.514	0.29
17_G	68_R	0.508	0.29
40_T	54_S	0.503	0.29
60_A	68_R	0.503	0.29
26_Y	37_G	0.500	0.28

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2lbmA	1	0.5541	38.6	0.867	Contact Map
3ql9A	1	0.4189	31.5	0.873	Contact Map
4qbbA	1	0.9595	12	0.896	Contact Map
4m0wA	1	0.973	5.5	0.91	Contact Map
1oqjA	1	0.7432	5.1	0.912	Contact Map
2zncA	2	0.8649	4.6	0.914	Contact Map
3fw3A	1	0.8649	3.9	0.917	Contact Map
1p4cA	3	0.3243	3.9	0.917	Contact Map
2wfvA	1	0.3108	3.8	0.917	Contact Map
1h5pA	1	0.8108	3.7	0.918	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.