DUF4830 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF4830 - Domain of unknown function (DUF4830)

PFAM:	PF16112	Sequences: FLESYGWEVDPEPIEVQEVTIPEEFDEVYEEYNELQKAQGFDLSKYAGKRVKRYTYEVTNYPGGEGGVRANLLVYKGKVIGGDI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	84 (84)
Sequences:	1129 (906)
Seq/√Len:	98.9
META:	0.891

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
2_L	70_A	4.769	1.00
10_D	57_E	3.324	1.00
46_Y	80_I	2.636	1.00
17_Q	53_R	2.528	1.00
18_E	50_R	2.354	1.00
16_V	52_K	2.120	1.00
1_F	41_F	2.063	1.00
18_E	52_K	2.009	1.00
33_N	42_D	1.948	1.00
51_V	80_I	1.946	1.00
55_T	71_N	1.936	1.00
56_Y	72_L	1.936	1.00
3_E	8_E	1.852	1.00
33_N	37_K	1.730	1.00
27_E	30_E	1.594	1.00
25_F	47_A	1.570	1.00
15_E	53_R	1.527	1.00
34_E	37_K	1.519	1.00
31_E	35_L	1.458	1.00
71_N	83_D	1.435	1.00
49_K	75_Y	1.427	1.00
54_Y	74_V	1.295	0.99
37_K	44_S	1.283	0.99
36_Q	39_Q	1.281	0.99
9_V	58_V	1.242	0.99
21_I	51_V	1.225	0.99
10_D	59_T	1.215	0.99
4_S	79_V	1.192	0.98
21_I	29_Y	1.180	0.98
5_Y	82_G	1.175	0.98
35_L	38_A	1.160	0.98
53_R	71_N	1.160	0.98
30_E	34_E	1.144	0.98
1_F	5_Y	1.143	0.98
53_R	73_L	1.113	0.97
1_F	4_S	1.106	0.97
7_W	39_Q	1.083	0.97
34_E	38_A	1.063	0.97
44_S	47_A	1.047	0.96
32_Y	36_Q	1.045	0.96
51_V	81_G	1.042	0.96
46_Y	75_Y	1.035	0.96
30_E	44_S	1.022	0.96
36_Q	83_D	1.015	0.96
58_V	70_A	1.011	0.96
31_E	34_E	0.974	0.95
21_I	47_A	0.971	0.94
23_E	49_K	0.938	0.93
29_Y	43_L	0.937	0.93
36_Q	54_Y	0.934	0.93
74_V	79_V	0.923	0.93
42_D	45_K	0.917	0.93
23_E	45_K	0.907	0.92
22_P	25_F	0.900	0.92
51_V	75_Y	0.889	0.91
8_E	60_N	0.879	0.91
29_Y	73_L	0.868	0.90
39_Q	45_K	0.866	0.90
19_V	28_V	0.835	0.89
16_V	50_R	0.822	0.88
5_Y	70_A	0.816	0.88
20_T	50_R	0.804	0.87
25_F	28_V	0.797	0.86
36_Q	43_L	0.788	0.86
2_L	82_G	0.785	0.85
8_E	24_E	0.783	0.85
49_K	76_K	0.777	0.85
45_K	76_K	0.765	0.84
33_N	83_D	0.759	0.83
39_Q	83_D	0.743	0.82
20_T	23_E	0.736	0.82
64_G	67_G	0.733	0.81
33_N	43_L	0.731	0.81
9_V	12_E	0.730	0.81
75_Y	80_I	0.722	0.80
61_Y	68_V	0.705	0.79
25_F	29_Y	0.699	0.78
79_V	82_G	0.697	0.78
3_E	11_P	0.694	0.78
16_V	29_Y	0.690	0.77
14_I	57_E	0.687	0.77
52_K	77_G	0.686	0.77
10_D	14_I	0.680	0.76
4_S	41_F	0.668	0.75
7_W	60_N	0.663	0.74
13_P	71_N	0.663	0.74
19_V	73_L	0.663	0.74
10_D	13_P	0.658	0.74
26_D	49_K	0.638	0.72
57_E	84_I	0.631	0.71
28_V	33_N	0.628	0.70
72_L	79_V	0.610	0.68
29_Y	71_N	0.604	0.67
7_W	61_Y	0.602	0.67
16_V	68_V	0.599	0.67
22_P	48_G	0.591	0.66
18_E	42_D	0.585	0.65
8_E	59_T	0.583	0.65
17_Q	37_K	0.580	0.64
20_T	52_K	0.579	0.64
60_N	68_V	0.577	0.64
28_V	31_E	0.573	0.63
2_L	55_T	0.572	0.63
32_Y	83_D	0.569	0.63
32_Y	35_L	0.561	0.62
27_E	31_E	0.560	0.62
45_K	75_Y	0.559	0.61
7_W	70_A	0.546	0.60
30_E	37_K	0.544	0.59
51_V	64_G	0.539	0.59
20_T	46_Y	0.539	0.59
50_R	73_L	0.537	0.58
2_L	29_Y	0.536	0.58
24_E	41_F	0.536	0.58
21_I	25_F	0.529	0.57
71_N	81_G	0.527	0.57
48_G	67_G	0.527	0.57
19_V	50_R	0.521	0.56
9_V	40_G	0.519	0.56
65_E	76_K	0.517	0.56
18_E	28_V	0.515	0.55
49_K	81_G	0.510	0.55
3_E	10_D	0.507	0.54
34_E	78_K	0.505	0.54
37_K	42_D	0.501	0.53
71_N	75_Y	0.500	0.53

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1winA	1	0.4524	17	0.871	Contact Map
4anrA	1	0.8095	10.3	0.883	Contact Map
4fvgA	2	0.2619	9.4	0.885	Contact Map
4p78C	1	0.5238	7.7	0.889	Contact Map
3frmA	3	0.881	5.9	0.895	Contact Map
3ubrA	2	0.7024	5.2	0.898	Contact Map
1rz4A	2	0.4881	4.7	0.9	Contact Map
3uxjA	2	0.9405	4.6	0.9	Contact Map
5c8tB	1	0.381	4.5	0.901	Contact Map
3wdgB	1	0.7857	4.5	0.901	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0043 seconds.