DUF4826 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF4826 - Domain of unknown function (DUF4826)

PFAM:	PF16108	Sequences: EEQEEAWCREQRQKAVKYLAEQGVVHGRVGEWPAWHVAPYVAIWAIESKDPGWVGWWVISGDLPTDYVSASVAKHPREALRHFALRWQLKAERLLRGEAHDKTQPELAPLLASRAELLYELAEDDELW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	128 (125)
Sequences:	597 (501)
Seq/√Len:	44.8
META:	0.869

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
11_Q	14_K	4.359	1.00
42_A	60_S	4.019	1.00
43_I	80_L	3.169	1.00
68_V	82_H	2.502	1.00
32_W	36_H	2.468	1.00
95_L	112_A	2.424	1.00
103_T	106_E	2.351	1.00
80_L	118_L	2.350	1.00
89_L	93_R	2.203	1.00
48_S	56_W	2.197	1.00
16_V	29_V	2.065	0.99
92_E	112_A	2.056	0.99
73_A	82_H	1.879	0.99
94_L	104_Q	1.856	0.99
24_V	28_R	1.853	0.99
82_H	86_R	1.829	0.99
6_A	10_E	1.771	0.98
86_R	90_K	1.770	0.98
110_L	114_R	1.736	0.98
11_Q	42_A	1.697	0.98
17_K	21_E	1.628	0.97
45_A	54_V	1.594	0.97
56_W	69_S	1.542	0.96
15_A	60_S	1.531	0.96
95_L	108_A	1.521	0.96
34_A	76_P	1.507	0.95
93_R	96_R	1.502	0.95
78_E	81_R	1.414	0.93
83_F	91_A	1.396	0.93
70_A	73_A	1.395	0.93
88_Q	115_A	1.323	0.91
107_L	114_R	1.323	0.91
45_A	48_S	1.322	0.91
109_P	113_S	1.322	0.91
83_F	119_Y	1.321	0.91
35_W	39_P	1.300	0.90
15_A	22_Q	1.276	0.89
36_H	39_P	1.244	0.88
88_Q	119_Y	1.242	0.88
30_G	34_A	1.206	0.87
19_L	22_Q	1.203	0.86
117_L	121_L	1.201	0.86
16_V	20_A	1.196	0.86
48_S	54_V	1.191	0.86
85_L	88_Q	1.164	0.84
93_R	100_H	1.161	0.84
28_R	58_V	1.154	0.84
99_A	103_T	1.150	0.84
119_Y	123_E	1.121	0.82
75_H	78_E	1.112	0.82
18_Y	67_Y	1.102	0.81
96_R	100_H	1.102	0.81
62_D	114_R	1.076	0.79
90_K	93_R	1.066	0.79
59_I	83_F	1.063	0.79
88_Q	116_E	1.062	0.79
85_L	89_L	1.051	0.78
92_E	96_R	1.044	0.77
11_Q	60_S	1.039	0.77
51_P	62_D	1.034	0.77
41_V	103_T	1.032	0.77
44_W	58_V	1.032	0.77
68_V	83_F	1.031	0.76
61_G	64_P	1.025	0.76
94_L	97_G	1.024	0.76
15_A	58_V	1.021	0.76
48_S	55_G	1.000	0.74
74_K	78_E	0.992	0.74
60_S	65_T	0.989	0.73
30_G	55_G	0.982	0.73
59_I	118_L	0.968	0.72
44_W	47_E	0.953	0.71
53_W	74_K	0.940	0.70
72_V	82_H	0.939	0.69
23_G	43_I	0.937	0.69
120_E	126_E	0.934	0.69
32_W	75_H	0.926	0.68
42_A	63_L	0.916	0.68
31_E	34_A	0.908	0.67
28_R	52_G	0.896	0.66
31_E	39_P	0.894	0.66
24_V	48_S	0.889	0.65
36_H	63_L	0.876	0.64
14_K	21_E	0.875	0.64
68_V	122_A	0.873	0.64
12_R	16_V	0.872	0.64
73_A	119_Y	0.868	0.63
93_R	116_E	0.850	0.62
69_S	74_K	0.844	0.61
29_V	63_L	0.843	0.61
113_S	121_L	0.838	0.61
49_K	85_L	0.835	0.60
33_P	36_H	0.834	0.60
72_V	84_A	0.829	0.60
13_Q	16_V	0.829	0.60
46_I	97_G	0.823	0.59
120_E	123_E	0.800	0.57
40_Y	84_A	0.796	0.57
64_P	114_R	0.790	0.56
41_V	63_L	0.776	0.55
73_A	91_A	0.775	0.55
112_A	116_E	0.773	0.54
48_S	51_P	0.772	0.54
12_R	29_V	0.770	0.54
8_C	32_W	0.765	0.54
18_Y	65_T	0.762	0.53
16_V	31_E	0.759	0.53
46_I	60_S	0.750	0.52
5_E	32_W	0.749	0.52
30_G	76_P	0.746	0.52
68_V	72_V	0.742	0.51
77_R	125_D	0.728	0.50
42_A	114_R	0.716	0.49
47_E	55_G	0.714	0.49
22_Q	67_Y	0.707	0.48
42_A	58_V	0.706	0.48
78_E	115_A	0.704	0.48
47_E	76_P	0.701	0.47
125_D	128_W	0.700	0.47
115_A	119_Y	0.699	0.47
54_V	69_S	0.698	0.47
39_P	44_W	0.695	0.47
66_D	86_R	0.689	0.46
30_G	45_A	0.672	0.45
41_V	91_A	0.672	0.45
92_E	121_L	0.671	0.45
120_E	127_L	0.670	0.44
105_P	115_A	0.668	0.44
84_A	119_Y	0.667	0.44
90_K	100_H	0.660	0.43
114_R	118_L	0.655	0.43
19_L	24_V	0.655	0.43
11_Q	40_Y	0.650	0.43
19_L	108_A	0.648	0.42
26_H	63_L	0.645	0.42
63_L	117_L	0.644	0.42
99_A	104_Q	0.636	0.41
39_P	80_L	0.635	0.41
5_E	8_C	0.630	0.41
78_E	91_A	0.628	0.40
23_G	89_L	0.622	0.40
95_L	98_E	0.620	0.40
73_A	85_L	0.618	0.40
92_E	95_L	0.617	0.39
59_I	120_E	0.616	0.39
43_I	79_A	0.613	0.39
15_A	35_W	0.613	0.39
88_Q	112_A	0.612	0.39
47_E	53_W	0.604	0.38
96_R	127_L	0.601	0.38
58_V	116_E	0.601	0.38
92_E	116_E	0.596	0.37
68_V	77_R	0.596	0.37
72_V	83_F	0.591	0.37
73_A	78_E	0.586	0.37
42_A	45_A	0.585	0.37
107_L	110_L	0.583	0.36
70_A	82_H	0.581	0.36
59_I	70_A	0.580	0.36
81_R	123_E	0.577	0.36
9_R	21_E	0.574	0.36
116_E	121_L	0.572	0.35
101_D	106_E	0.568	0.35
85_L	93_R	0.564	0.35
85_L	119_Y	0.561	0.34
16_V	25_V	0.560	0.34
50_D	81_R	0.558	0.34
26_H	56_W	0.556	0.34
10_E	13_Q	0.552	0.34
34_A	39_P	0.546	0.33
25_V	46_I	0.545	0.33
28_R	47_E	0.543	0.33
38_A	41_V	0.542	0.33
80_L	115_A	0.542	0.33
68_V	86_R	0.540	0.33
72_V	106_E	0.534	0.32
86_R	116_E	0.531	0.32
35_W	41_V	0.529	0.32
8_C	36_H	0.527	0.31
46_I	56_W	0.524	0.31
62_D	113_S	0.516	0.31
33_P	45_A	0.515	0.30
6_A	99_A	0.509	0.30
53_W	68_V	0.508	0.30
21_E	99_A	0.508	0.30
54_V	74_K	0.503	0.29
18_Y	44_W	0.502	0.29
93_R	121_L	0.500	0.29

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
5a2tA	12	0.8359	8.1	0.943	Contact Map
2y4iB	1	0.8828	6.3	0.946	Contact Map
4azsA	6	0.7891	6	0.946	Contact Map
4doxA	1	0.8594	6	0.946	Contact Map
3ksxA	1	0.2969	5.5	0.947	Contact Map
2mpkA	1	0.4766	5.4	0.947	Contact Map
2yj1B	1	0.1172	5.3	0.948	Contact Map
2b9wA	1	0.6562	5	0.948	Contact Map
4lv5A	1	0.9297	5	0.948	Contact Map
4y85A	1	0.9062	4.3	0.95	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.