Phage_holin_5_2 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Phage_holin_5_2 - Phage holin family Hol44, in holin superfamily V

PFAM:	PF16079	Sequences: IVVICYLIGYILKKTPKIPDKYIPLILGVLGIVLGVVAVFAMDFPATDILIFGAILQGILSGLAATGLNQLVKQL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	75 (74)
Sequences:	1843 (1420)
Seq/√Len:	165.0
META:	0.812

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
9_G	27_L	3.172	1.00
16_P	21_K	2.757	1.00
6_Y	69_N	2.370	1.00
9_G	23_I	2.209	1.00
70_Q	74_Q	2.197	1.00
6_Y	10_Y	2.012	1.00
63_L	67_G	1.813	1.00
15_T	25_L	1.726	1.00
7_L	63_L	1.710	1.00
28_G	67_G	1.670	1.00
5_C	9_G	1.666	1.00
8_I	30_L	1.624	1.00
28_G	59_I	1.593	1.00
35_G	54_A	1.589	1.00
27_L	62_G	1.559	1.00
21_K	25_L	1.557	1.00
31_G	58_G	1.545	1.00
5_C	27_L	1.541	1.00
12_L	26_I	1.541	1.00
62_G	67_G	1.498	1.00
32_I	59_I	1.495	1.00
10_Y	14_K	1.475	1.00
66_T	70_Q	1.396	1.00
4_I	56_L	1.345	1.00
18_I	26_I	1.337	1.00
57_Q	60_L	1.326	1.00
64_A	67_G	1.325	1.00
27_L	65_A	1.302	1.00
38_A	42_M	1.272	1.00
1_I	35_G	1.246	1.00
49_I	52_F	1.238	1.00
7_L	28_G	1.219	1.00
5_C	62_G	1.219	1.00
6_Y	68_L	1.171	1.00
6_Y	65_A	1.079	1.00
48_D	51_I	1.038	0.99
49_I	53_G	1.034	0.99
27_L	66_T	1.031	0.99
21_K	74_Q	1.023	0.99
3_V	64_A	1.014	0.99
1_I	61_S	1.010	0.99
24_P	31_G	0.993	0.99
22_Y	26_I	0.982	0.99
31_G	64_A	0.956	0.99
4_I	59_I	0.929	0.99
6_Y	72_V	0.920	0.98
35_G	57_Q	0.918	0.98
3_V	56_L	0.913	0.98
69_N	74_Q	0.913	0.98
20_D	23_I	0.884	0.98
28_G	63_L	0.870	0.98
5_C	31_G	0.840	0.97
15_T	18_I	0.826	0.97
44_F	48_D	0.808	0.96
38_A	50_L	0.802	0.96
12_L	15_T	0.800	0.96
26_I	30_L	0.794	0.96
68_L	72_V	0.793	0.96
28_G	71_L	0.792	0.96
12_L	18_I	0.768	0.95
23_I	27_L	0.752	0.95
41_A	49_I	0.748	0.95
19_P	22_Y	0.743	0.94
47_T	50_L	0.735	0.94
6_Y	70_Q	0.718	0.93
39_V	50_L	0.708	0.93
4_I	34_L	0.705	0.93
34_L	65_A	0.701	0.92
39_V	43_D	0.701	0.92
57_Q	61_S	0.701	0.92
1_I	5_C	0.701	0.92
6_Y	24_P	0.700	0.92
26_I	29_V	0.687	0.92
33_V	47_T	0.686	0.92
54_A	57_Q	0.677	0.91
42_M	45_P	0.666	0.90
11_I	28_G	0.665	0.90
61_S	65_A	0.660	0.90
49_I	55_I	0.659	0.90
63_L	68_L	0.647	0.89
68_L	71_L	0.642	0.89
10_Y	23_I	0.638	0.88
20_D	70_Q	0.637	0.88
65_A	68_L	0.635	0.88
9_G	20_D	0.634	0.88
38_A	45_P	0.627	0.88
32_I	60_L	0.616	0.87
11_I	25_L	0.604	0.86
6_Y	66_T	0.595	0.85
69_N	73_K	0.590	0.84
22_Y	25_L	0.578	0.83
56_L	60_L	0.578	0.83
46_A	53_G	0.576	0.83
71_L	74_Q	0.570	0.82
35_G	61_S	0.569	0.82
23_I	66_T	0.558	0.81
39_V	42_M	0.554	0.80
13_K	20_D	0.552	0.80
2_V	64_A	0.552	0.80
31_G	35_G	0.551	0.80
37_V	40_F	0.546	0.79
4_I	30_L	0.534	0.78
1_I	34_L	0.532	0.78
29_V	36_V	0.531	0.78
50_L	53_G	0.530	0.77
32_I	55_I	0.528	0.77
18_I	22_Y	0.519	0.76
33_V	52_F	0.512	0.75
36_V	46_A	0.503	0.74
12_L	27_L	0.503	0.74
43_D	46_A	0.500	0.73

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4cz8A	2	0.9867	6.8	0.865	Contact Map
4czbA	2	1	6.7	0.866	Contact Map
3dh4A	3	0.8533	5	0.874	Contact Map
4pgrA	1	1	4.5	0.876	Contact Map
4bwzA	2	0.9867	4.2	0.878	Contact Map
1u7gA	3	0.88	4	0.88	Contact Map
2xq2A	2	0.8533	3.9	0.88	Contact Map
3hd6A	3	0.9733	3.7	0.881	Contact Map
2b2hA	3	0.8667	3.5	0.883	Contact Map
4ldsA	2	0.92	3.3	0.884	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0045 seconds.