Acyltransf_C - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Acyltransf_C - Acyltransferase C-terminus

PFAM:	PF16076	Sequences: MDLLNGKPSEVHVHVRRIPIKDIPEDEEELAQWLHDRFQEKDALLEEFYETGTFPAPGEEVELPRRPKSLLNFLFW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	76 (72)
Sequences:	963 (665)
Seq/√Len:	78.4
META:	0.221

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
47_E	51_T	3.658	1.00
12_H	48_F	3.277	1.00
16_R	40_E	2.740	1.00
26_D	29_E	2.593	1.00
32_Q	36_D	2.392	1.00
46_E	50_E	2.205	1.00
23_I	30_L	2.148	1.00
24_P	33_W	2.147	1.00
37_R	40_E	2.064	1.00
14_H	44_L	2.037	1.00
36_D	39_Q	1.908	1.00
47_E	55_P	1.835	1.00
36_D	40_E	1.445	0.99
45_L	49_Y	1.424	0.99
39_Q	43_A	1.422	0.99
66_R	69_S	1.421	0.99
11_V	45_L	1.352	0.98
20_I	23_I	1.338	0.98
23_I	33_W	1.332	0.98
35_H	39_Q	1.294	0.98
43_A	47_E	1.251	0.97
18_I	37_R	1.249	0.97
7_K	38_F	1.204	0.97
65_R	68_K	1.198	0.97
31_A	35_H	1.166	0.96
5_N	16_R	1.164	0.96
7_K	13_V	1.122	0.95
19_P	22_D	1.106	0.95
29_E	32_Q	1.092	0.94
42_D	46_E	1.079	0.94
38_F	42_D	1.055	0.93
34_L	41_K	1.028	0.92
71_L	74_L	1.010	0.92
35_H	38_F	0.970	0.90
59_E	62_E	0.959	0.90
60_E	63_L	0.923	0.88
67_P	70_L	0.919	0.87
28_E	39_Q	0.898	0.86
33_W	45_L	0.889	0.86
42_D	49_Y	0.885	0.85
13_V	42_D	0.883	0.85
69_S	72_N	0.880	0.85
11_V	15_V	0.877	0.85
67_P	74_L	0.862	0.84
37_R	48_F	0.858	0.84
47_E	53_T	0.857	0.84
28_E	31_A	0.831	0.82
8_P	38_F	0.829	0.81
30_L	38_F	0.823	0.81
30_L	45_L	0.822	0.81
65_R	69_S	0.801	0.79
32_Q	35_H	0.799	0.79
58_G	63_L	0.794	0.79
42_D	52_G	0.789	0.78
18_I	23_I	0.781	0.77
44_L	55_P	0.765	0.76
8_P	13_V	0.762	0.76
57_P	60_E	0.751	0.75
18_I	40_E	0.739	0.73
22_D	29_E	0.738	0.73
53_T	57_P	0.736	0.73
48_F	53_T	0.732	0.73
23_I	26_D	0.731	0.73
7_K	42_D	0.721	0.72
13_V	38_F	0.720	0.71
11_V	14_H	0.720	0.71
53_T	61_V	0.714	0.71
52_G	55_P	0.707	0.70
44_L	52_G	0.706	0.70
68_K	73_F	0.706	0.70
34_L	62_E	0.703	0.70
17_R	24_P	0.703	0.70
32_Q	39_Q	0.696	0.69
67_P	73_F	0.695	0.69
68_K	74_L	0.690	0.68
15_V	49_Y	0.687	0.68
46_E	51_T	0.683	0.67
34_L	44_L	0.681	0.67
19_P	38_F	0.680	0.67
15_V	25_E	0.665	0.65
8_P	11_V	0.655	0.64
7_K	10_E	0.655	0.64
17_R	20_I	0.652	0.64
65_R	72_N	0.646	0.63
8_P	45_L	0.646	0.63
19_P	25_E	0.646	0.63
16_R	24_P	0.641	0.63
25_E	30_L	0.638	0.62
65_R	70_L	0.634	0.62
51_T	58_G	0.629	0.61
21_K	29_E	0.622	0.60
17_R	65_R	0.621	0.60
9_S	15_V	0.621	0.60
7_K	15_V	0.615	0.59
22_D	25_E	0.605	0.58
9_S	12_H	0.597	0.57
42_D	55_P	0.597	0.57
9_S	42_D	0.565	0.53
40_E	71_L	0.562	0.53
21_K	25_E	0.552	0.51
68_K	71_L	0.526	0.48
69_S	73_F	0.522	0.48
59_E	63_L	0.517	0.47
21_K	64_P	0.508	0.46
3_L	7_K	0.507	0.46
42_D	54_F	0.504	0.45
16_R	21_K	0.503	0.45
53_T	56_A	0.500	0.45

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3pt1A	1	0.8684	14.1	0.881	Contact Map
3ts9A	1	0.6711	7.1	0.896	Contact Map
2ellA	1	0.3816	6.2	0.899	Contact Map
3it3A	2	0.8816	5.2	0.902	Contact Map
3tbiA	1	0.4079	4.8	0.904	Contact Map
3fs8A	3	0.4868	4.5	0.905	Contact Map
3k93A	3	0.5789	4	0.908	Contact Map
2jttC	1	0.3421	2.8	0.915	Contact Map
2q83A	1	0.6316	2.7	0.915	Contact Map
3exaA	2	0.5526	2.5	0.917	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0044 seconds.