DUF4782 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF4782 - Domain of unknown function (DUF4782)

PFAM:	PF16016	Sequences: VLLDEVFPISVEKLFELLFGDDSSFFKKFLEERQGDTDISIGPWKKDESGGLTRTVSYTKPLNGPIGPKQTKCTETQTYLLENDDLGKYYLVVTTTQTPHDVPYGDYFRVETRYCITWASNNSKSTCRLRVSTGVEWLKSTWLKGKIEKGAIDG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	154 (149)
Sequences:	1609 (1233)
Seq/√Len:	101.0
META:	0.259

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
4_D	128_R	5.712	1.00
38_D	59_T	4.472	1.00
109_R	138_L	3.512	1.00
119_A	123_S	3.170	1.00
107_Y	141_T	2.912	1.00
37_T	70_Q	2.825	1.00
27_K	31_E	2.816	1.00
146_K	150_G	2.809	1.00
101_D	105_G	2.712	1.00
117_T	130_R	2.561	1.00
114_Y	129_L	2.401	1.00
9_I	14_L	2.299	1.00
14_L	116_I	2.063	1.00
54_R	77_Q	2.052	1.00
19_F	114_Y	2.018	1.00
14_L	18_L	1.999	1.00
133_T	152_I	1.886	1.00
72_K	101_D	1.876	1.00
6_V	128_R	1.828	1.00
104_Y	107_Y	1.796	1.00
99_P	105_G	1.779	1.00
10_S	13_K	1.774	1.00
106_D	139_K	1.765	1.00
99_P	102_V	1.699	1.00
144_K	148_E	1.681	1.00
11_V	127_C	1.673	1.00
44_W	54_R	1.656	1.00
15_F	79_Y	1.641	1.00
83_N	89_Y	1.609	1.00
55_T	74_T	1.559	1.00
115_C	132_S	1.517	1.00
26_F	30_L	1.509	1.00
59_T	70_Q	1.454	1.00
104_Y	141_T	1.454	1.00
112_T	133_T	1.452	1.00
107_Y	139_K	1.452	1.00
44_W	77_Q	1.421	1.00
71_T	102_V	1.414	1.00
90_Y	116_I	1.398	1.00
143_L	146_K	1.375	0.99
68_P	71_T	1.338	0.99
58_Y	154_G	1.326	0.99
33_R	36_D	1.316	0.99
6_V	119_A	1.313	0.99
82_E	93_V	1.260	0.99
36_D	60_K	1.259	0.99
102_V	108_F	1.259	0.99
36_D	75_E	1.241	0.99
30_L	39_I	1.217	0.99
62_L	154_G	1.202	0.99
3_L	129_L	1.197	0.99
73_C	101_D	1.195	0.99
7_F	18_L	1.181	0.98
62_L	68_P	1.177	0.98
6_V	126_T	1.101	0.97
58_Y	98_T	1.099	0.97
2_L	133_T	1.089	0.97
11_V	118_W	1.083	0.97
25_F	29_F	1.067	0.97
40_S	57_S	1.065	0.97
24_S	28_K	1.064	0.97
21_D	24_S	1.057	0.97
74_T	96_T	1.017	0.96
32_E	136_E	1.014	0.96
117_T	128_R	1.007	0.96
74_T	99_P	1.007	0.96
137_W	147_I	1.003	0.96
91_L	115_C	0.986	0.95
113_R	132_S	0.985	0.95
143_L	147_I	0.982	0.95
62_L	65_P	0.980	0.95
84_D	87_G	0.977	0.95
30_L	58_Y	0.961	0.95
60_K	71_T	0.955	0.94
29_F	33_R	0.950	0.94
44_W	56_V	0.947	0.94
111_E	136_E	0.943	0.94
42_G	55_T	0.941	0.94
71_T	101_D	0.931	0.94
95_T	111_E	0.931	0.94
7_F	14_L	0.929	0.93
121_N	128_R	0.928	0.93
103_P	108_F	0.927	0.93
36_D	151_A	0.926	0.93
65_P	71_T	0.923	0.93
11_V	116_I	0.917	0.93
15_F	19_F	0.913	0.93
22_D	134_G	0.905	0.93
11_V	15_F	0.904	0.93
58_Y	73_C	0.881	0.92
105_G	108_F	0.872	0.91
26_F	39_I	0.870	0.91
66_I	104_Y	0.859	0.90
37_T	59_T	0.857	0.90
149_K	153_D	0.856	0.90
37_T	61_P	0.844	0.90
56_V	77_Q	0.838	0.89
104_Y	139_K	0.833	0.89
150_G	153_D	0.830	0.89
44_W	116_I	0.827	0.89
120_S	142_W	0.809	0.88
75_E	114_Y	0.807	0.88
73_C	99_P	0.802	0.87
120_S	123_S	0.793	0.87
20_G	23_S	0.793	0.87
14_L	25_F	0.784	0.86
13_K	16_E	0.782	0.86
3_L	25_F	0.773	0.85
59_T	72_K	0.770	0.85
102_V	144_K	0.766	0.85
42_G	45_K	0.765	0.85
41_I	56_V	0.764	0.85
123_S	126_T	0.763	0.84
28_K	32_E	0.759	0.84
64_G	67_G	0.755	0.84
82_E	86_L	0.755	0.84
49_S	74_T	0.752	0.84
109_R	140_S	0.748	0.83
85_D	118_W	0.740	0.83
93_V	137_W	0.740	0.83
60_K	154_G	0.732	0.82
74_T	97_Q	0.729	0.82
53_T	136_E	0.720	0.81
110_V	150_G	0.716	0.80
53_T	92_V	0.716	0.80
2_L	5_E	0.716	0.80
30_L	78_T	0.711	0.80
36_D	77_Q	0.707	0.80
29_F	75_E	0.705	0.79
64_G	142_W	0.698	0.79
65_P	68_P	0.698	0.79
41_I	50_G	0.696	0.79
36_D	61_P	0.695	0.78
47_D	127_C	0.694	0.78
48_E	51_G	0.693	0.78
53_T	78_T	0.681	0.77
82_E	92_V	0.680	0.77
35_G	61_P	0.675	0.76
14_L	129_L	0.675	0.76
110_V	151_A	0.673	0.76
30_L	36_D	0.672	0.76
53_T	76_T	0.670	0.76
137_W	148_E	0.665	0.75
12_E	16_E	0.665	0.75
109_R	129_L	0.665	0.75
3_L	7_F	0.663	0.75
23_S	44_W	0.656	0.74
75_E	112_T	0.655	0.74
86_L	90_Y	0.647	0.73
102_V	110_V	0.643	0.73
4_D	136_E	0.639	0.72
9_I	117_T	0.638	0.72
19_F	116_I	0.637	0.72
76_T	109_R	0.636	0.72
41_I	149_K	0.632	0.72
30_L	33_R	0.625	0.71
119_A	126_T	0.625	0.71
52_L	116_I	0.624	0.71
21_D	27_K	0.623	0.71
67_G	108_F	0.622	0.70
19_F	132_S	0.619	0.70
12_E	116_I	0.618	0.70
18_L	147_I	0.617	0.70
10_S	20_G	0.617	0.70
95_T	109_R	0.611	0.69
24_S	103_P	0.607	0.69
35_G	73_C	0.603	0.68
74_T	98_T	0.597	0.67
18_L	95_T	0.593	0.67
18_L	23_S	0.593	0.67
58_Y	104_Y	0.592	0.67
96_T	111_E	0.588	0.66
29_F	36_D	0.583	0.66
62_L	69_K	0.582	0.65
51_G	55_T	0.582	0.65
14_L	19_F	0.577	0.65
62_L	66_I	0.575	0.64
39_I	103_P	0.575	0.64
14_L	114_Y	0.574	0.64
8_P	39_I	0.571	0.64
43_P	119_A	0.571	0.64
24_S	46_K	0.565	0.63
39_I	71_T	0.564	0.63
12_E	87_G	0.561	0.63
98_T	113_R	0.557	0.62
109_R	136_E	0.556	0.62
46_K	53_T	0.556	0.62
4_D	18_L	0.555	0.62
16_E	22_D	0.552	0.61
33_R	60_K	0.551	0.61
60_K	63_N	0.551	0.61
10_S	15_F	0.550	0.61
67_G	135_V	0.547	0.61
135_V	147_I	0.546	0.60
106_D	135_V	0.545	0.60
54_R	58_Y	0.545	0.60
67_G	102_V	0.545	0.60
62_L	71_T	0.545	0.60
62_L	151_A	0.543	0.60
140_S	152_I	0.541	0.60
47_D	51_G	0.538	0.59
20_G	101_D	0.537	0.59
72_K	148_E	0.534	0.59
39_I	42_G	0.533	0.59
57_S	139_K	0.533	0.59
68_P	103_P	0.531	0.58
7_F	43_P	0.530	0.58
44_W	115_C	0.528	0.58
47_D	52_L	0.527	0.58
9_I	16_E	0.525	0.58
21_D	43_P	0.525	0.58
2_L	58_Y	0.525	0.58
116_I	127_C	0.523	0.57
38_D	61_P	0.520	0.57
43_P	128_R	0.514	0.56
83_N	88_K	0.513	0.56
12_E	84_D	0.512	0.56
64_G	73_C	0.512	0.56
113_R	117_T	0.505	0.55
90_Y	93_V	0.504	0.55
17_L	25_F	0.503	0.54
30_L	75_E	0.503	0.54
7_F	17_L	0.502	0.54
25_F	110_V	0.500	0.54

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3p0lA	1	0.8831	45.7	0.89	Contact Map
4c9cA	1	0.8247	45.3	0.89	Contact Map
2qimA	1	0.8506	40.8	0.893	Contact Map
4jhgA	2	0.8442	40.3	0.893	Contact Map
1ln1A	1	0.8896	40.3	0.893	Contact Map
2wqlA	4	0.8442	39.8	0.893	Contact Map
1icxA	1	0.8506	29.6	0.9	Contact Map
4bk7A	1	0.8636	28.6	0.901	Contact Map
3qszA	1	0.8636	22.7	0.906	Contact Map
2r55A	1	0.8831	22.2	0.906	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.