EFTUD2 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

EFTUD2 - 116 kDa U5 small nuclear ribonucleoprotein component N-terminus

PFAM:	PF16004	Sequences: DDLYDEFGNYIGPELDSDEEEDEEEDEEADDDDDEEEEEDEGEEGEDEDEELMDEDEEDDDEPPSNAVVLHEDKKYYPSAEEVYGPDVETLVQEEDAQPLTEPIIAPVKVKKFTVEEKDLP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	121 (118)
Sequences:	653 (533)
Seq/√Len:	49.1
META:	0.329

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
75_K	82_E	5.263	1.00
93_Q	97_A	3.625	1.00
102_E	106_A	2.940	1.00
85_G	88_V	2.607	1.00
103_P	107_P	2.597	1.00
78_P	83_V	2.587	1.00
10_Y	13_P	2.389	1.00
53_M	56_D	2.360	1.00
58_E	61_D	2.220	1.00
79_S	100_L	2.071	1.00
72_E	77_Y	2.030	1.00
89_E	93_Q	1.983	0.99
70_L	74_K	1.870	0.99
3_L	13_P	1.858	0.99
117_E	121_P	1.851	0.99
55_E	58_E	1.827	0.99
70_L	73_D	1.826	0.99
18_D	21_E	1.797	0.99
79_S	88_V	1.653	0.98
79_S	85_G	1.631	0.98
30_D	33_D	1.552	0.97
10_Y	15_L	1.545	0.97
94_E	98_Q	1.544	0.97
13_P	82_E	1.518	0.97
56_D	59_D	1.465	0.96
74_K	77_Y	1.429	0.95
88_V	112_K	1.421	0.95
71_H	76_Y	1.398	0.95
10_Y	109_K	1.382	0.94
51_E	54_D	1.375	0.94
101_T	104_I	1.367	0.94
89_E	99_P	1.323	0.93
4_Y	12_G	1.283	0.92
113_F	120_L	1.277	0.91
91_L	105_I	1.268	0.91
88_V	106_A	1.246	0.90
23_E	26_D	1.209	0.89
68_V	72_E	1.205	0.89
55_E	60_D	1.203	0.89
81_E	86_P	1.194	0.88
2_D	17_S	1.183	0.88
27_E	32_D	1.172	0.87
25_E	28_E	1.165	0.87
76_Y	98_Q	1.162	0.87
73_D	76_Y	1.126	0.85
28_E	32_D	1.119	0.85
5_D	8_G	1.116	0.85
70_L	77_Y	1.114	0.85
24_E	27_E	1.112	0.85
75_K	104_I	1.108	0.84
34_D	38_E	1.098	0.84
97_A	115_V	1.059	0.82
47_D	52_L	1.051	0.81
76_Y	89_E	1.025	0.79
27_E	31_D	1.023	0.79
21_E	24_E	1.016	0.79
66_N	88_V	1.014	0.79
87_D	118_K	0.984	0.77
25_E	37_E	0.975	0.76
86_P	91_L	0.971	0.76
29_A	36_E	0.967	0.75
89_E	92_V	0.953	0.74
67_A	97_A	0.947	0.74
71_H	88_V	0.947	0.74
84_Y	105_I	0.942	0.73
37_E	40_D	0.929	0.72
70_L	80_A	0.913	0.71
91_L	116_E	0.910	0.71
48_E	51_E	0.908	0.71
89_E	98_Q	0.893	0.69
94_E	101_T	0.892	0.69
5_D	9_N	0.888	0.69
93_Q	99_P	0.886	0.69
33_D	37_E	0.880	0.68
44_E	47_D	0.876	0.68
41_E	47_D	0.870	0.67
71_H	93_Q	0.860	0.66
77_Y	96_D	0.844	0.65
27_E	30_D	0.841	0.65
101_T	116_E	0.838	0.64
93_Q	101_T	0.833	0.64
29_A	32_D	0.829	0.63
21_E	26_D	0.825	0.63
25_E	29_A	0.817	0.62
89_E	94_E	0.805	0.61
73_D	77_Y	0.797	0.60
101_T	114_T	0.794	0.60
65_S	113_F	0.792	0.60
4_Y	7_F	0.787	0.59
13_P	109_K	0.783	0.59
105_I	119_D	0.782	0.59
104_I	117_E	0.781	0.59
4_Y	10_Y	0.777	0.58
63_P	111_K	0.776	0.58
6_E	9_N	0.765	0.57
57_E	61_D	0.760	0.57
74_K	96_D	0.756	0.56
17_S	90_T	0.755	0.56
35_E	39_E	0.752	0.56
13_P	69_V	0.750	0.56
53_M	57_E	0.747	0.55
72_E	76_Y	0.742	0.55
82_E	86_P	0.740	0.55
70_L	96_D	0.736	0.54
54_D	64_P	0.728	0.54
79_S	102_E	0.725	0.53
38_E	45_G	0.715	0.52
32_D	36_E	0.713	0.52
32_D	35_E	0.704	0.51
77_Y	94_E	0.703	0.51
78_P	92_V	0.697	0.50
4_Y	8_G	0.696	0.50
59_D	64_P	0.691	0.50
74_K	80_A	0.690	0.50
28_E	31_D	0.688	0.49
68_V	73_D	0.683	0.49
16_D	19_E	0.680	0.49
75_K	114_T	0.680	0.49
49_D	52_L	0.680	0.49
116_E	119_D	0.674	0.48
79_S	90_T	0.672	0.48
9_N	12_G	0.667	0.47
16_D	88_V	0.666	0.47
58_E	62_E	0.662	0.47
51_E	57_E	0.660	0.47
24_E	108_V	0.654	0.46
26_D	29_A	0.652	0.46
13_P	116_E	0.650	0.46
85_G	92_V	0.650	0.46
57_E	60_D	0.642	0.45
52_L	56_D	0.640	0.45
26_D	30_D	0.640	0.45
37_E	44_E	0.638	0.44
75_K	106_A	0.637	0.44
71_H	114_T	0.636	0.44
31_D	39_E	0.635	0.44
36_E	40_D	0.634	0.44
75_K	81_E	0.632	0.44
22_D	50_E	0.628	0.43
70_L	76_Y	0.627	0.43
50_E	54_D	0.625	0.43
115_V	119_D	0.622	0.43
52_L	55_E	0.614	0.42
75_K	79_S	0.613	0.42
70_L	85_G	0.603	0.41
69_V	119_D	0.602	0.41
44_E	48_E	0.585	0.39
23_E	27_E	0.584	0.39
36_E	58_E	0.580	0.39
67_A	78_P	0.579	0.39
22_D	25_E	0.575	0.38
112_K	119_D	0.564	0.37
45_G	48_E	0.563	0.37
53_M	59_D	0.561	0.37
69_V	76_Y	0.561	0.37
23_E	39_E	0.559	0.37
80_A	94_E	0.558	0.37
33_D	36_E	0.555	0.36
8_G	12_G	0.550	0.36
110_V	119_D	0.549	0.36
90_T	97_A	0.547	0.36
60_D	63_P	0.541	0.35
10_Y	119_D	0.539	0.35
65_S	89_E	0.535	0.34
104_I	116_E	0.534	0.34
102_E	116_E	0.533	0.34
36_E	56_D	0.528	0.34
92_V	95_E	0.528	0.34
71_H	94_E	0.526	0.34
87_D	94_E	0.519	0.33
74_K	85_G	0.516	0.33
75_K	78_P	0.511	0.32
46_E	105_I	0.508	0.32
84_Y	95_E	0.508	0.32
76_Y	94_E	0.506	0.32
68_V	84_Y	0.501	0.31
77_Y	80_A	0.500	0.31

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4h31A	3	0.3636	4.3	0.945	Contact Map
4u7aA	1	0	4	0.946	Contact Map
2mn2A	1	0.3471	2.8	0.95	Contact Map
2p9rA	1	0.4463	2.2	0.953	Contact Map
4y66B	1	0.3306	1.9	0.955	Contact Map
4fp9B	2	0.1488	1.8	0.955	Contact Map
4ipeA	2	0.8512	1.6	0.956	Contact Map
2yzyA	1	0.3388	1.6	0.956	Contact Map
1f1sA	1	0.5124	1.4	0.957	Contact Map
2ca6A	1	0.157	1.3	0.959	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.