ComGF - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ComGF - Putative Competence protein ComGF

PFAM:	PF15980	Sequences: QYSQIKQYLQQDEQIEWELFLQQLEKELRESKLVKVEGNKLYLKKDGKTITYEKYGNKIRRRVNGKGHEPLLQNVKSVSFEQEGNGLTIKVTFENGEEY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	99 (92)
Sequences:	816 (681)
Seq/√Len:	71.0
META:	0.322

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
60_R	68_H	4.778	1.00
55_Y	60_R	4.211	1.00
55_Y	68_H	3.740	1.00
17_W	21_L	3.238	1.00
53_E	62_R	2.803	1.00
19_L	23_Q	2.617	1.00
70_P	73_Q	2.359	1.00
58_K	68_H	2.252	1.00
53_E	60_R	2.219	1.00
21_L	66_K	2.197	1.00
61_R	69_E	2.087	1.00
76_K	92_T	1.737	1.00
52_Y	71_L	1.628	0.99
20_F	72_L	1.594	0.99
83_E	86_G	1.572	0.99
48_K	64_N	1.520	0.99
50_I	63_V	1.486	0.99
92_T	98_E	1.472	0.99
41_L	87_L	1.439	0.99
18_E	25_E	1.431	0.99
55_Y	58_K	1.423	0.98
17_W	91_V	1.410	0.98
40_K	51_T	1.263	0.97
75_V	91_V	1.205	0.96
80_F	89_I	1.204	0.96
27_E	61_R	1.196	0.96
14_Q	69_E	1.178	0.95
34_V	44_K	1.128	0.94
86_G	90_K	1.095	0.93
59_I	63_V	1.061	0.92
39_N	79_S	1.060	0.92
42_Y	45_K	1.060	0.92
81_E	88_T	1.058	0.92
50_I	54_K	1.048	0.91
43_L	46_D	1.046	0.91
25_E	93_F	1.026	0.90
20_F	61_R	1.025	0.90
54_K	75_V	1.019	0.90
15_I	25_E	1.008	0.89
79_S	90_K	1.005	0.89
53_E	56_G	0.998	0.89
57_N	94_E	0.989	0.89
35_K	94_E	0.983	0.88
18_E	71_L	0.977	0.88
17_W	93_F	0.976	0.88
48_K	79_S	0.974	0.88
58_K	73_Q	0.952	0.87
30_E	45_K	0.948	0.86
75_V	78_V	0.936	0.86
18_E	21_L	0.934	0.86
72_L	87_L	0.923	0.85
29_R	87_L	0.910	0.84
16_E	23_Q	0.909	0.84
23_Q	69_E	0.900	0.83
54_K	57_N	0.897	0.83
16_E	73_Q	0.896	0.83
53_E	68_H	0.890	0.83
36_V	85_N	0.888	0.83
72_L	91_V	0.887	0.82
13_E	93_F	0.886	0.82
50_I	61_R	0.885	0.82
15_I	18_E	0.884	0.82
20_F	27_E	0.883	0.82
27_E	47_G	0.861	0.81
11_Q	16_E	0.856	0.80
73_Q	93_F	0.837	0.79
27_E	69_E	0.833	0.78
77_S	92_T	0.828	0.78
23_Q	31_S	0.823	0.77
42_Y	47_G	0.820	0.77
22_Q	89_I	0.817	0.77
16_E	52_Y	0.801	0.76
15_I	19_L	0.774	0.73
39_N	54_K	0.756	0.71
90_K	98_E	0.754	0.71
38_G	77_S	0.754	0.71
74_N	94_E	0.752	0.71
7_Q	11_Q	0.751	0.71
58_K	70_P	0.734	0.69
82_Q	92_T	0.732	0.69
51_T	65_G	0.718	0.67
41_L	53_E	0.713	0.67
17_W	20_F	0.710	0.66
31_S	43_L	0.706	0.66
32_K	41_L	0.704	0.66
77_S	98_E	0.700	0.65
10_Q	89_I	0.699	0.65
69_E	73_Q	0.694	0.65
46_D	56_G	0.693	0.65
40_K	43_L	0.691	0.64
49_T	77_S	0.690	0.64
23_Q	27_E	0.687	0.64
22_Q	61_R	0.680	0.63
24_L	52_Y	0.664	0.61
19_L	89_I	0.659	0.61
23_Q	72_L	0.638	0.58
25_E	30_E	0.631	0.57
37_E	56_G	0.631	0.57
57_N	68_H	0.630	0.57
37_E	40_K	0.626	0.57
31_S	49_T	0.626	0.57
27_E	93_F	0.626	0.57
37_E	54_K	0.603	0.54
51_T	62_R	0.603	0.54
44_K	85_N	0.602	0.54
49_T	79_S	0.596	0.53
14_Q	22_Q	0.584	0.52
13_E	16_E	0.579	0.51
61_R	70_P	0.577	0.51
26_K	30_E	0.575	0.51
62_R	68_H	0.565	0.49
76_K	79_S	0.559	0.49
63_V	69_E	0.558	0.48
85_N	88_T	0.555	0.48
41_L	78_V	0.554	0.48
7_Q	12_D	0.552	0.48
21_L	25_E	0.551	0.48
30_E	71_L	0.546	0.47
22_Q	25_E	0.544	0.47
12_D	74_N	0.542	0.47
17_W	70_P	0.540	0.46
82_Q	87_L	0.531	0.45
25_E	29_R	0.524	0.44
60_R	63_V	0.523	0.44
20_F	23_Q	0.520	0.44
78_V	89_I	0.520	0.44
8_Y	13_E	0.516	0.43
91_V	95_N	0.514	0.43
86_G	91_V	0.514	0.43
37_E	48_K	0.513	0.43
35_K	59_I	0.512	0.43
57_N	92_T	0.510	0.43
72_L	75_V	0.508	0.42
13_E	95_N	0.506	0.42
20_F	59_I	0.504	0.42
46_D	98_E	0.503	0.42
76_K	96_G	0.500	0.41
38_G	51_T	0.500	0.41

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ci0J	1	0.8788	46	0.822	Contact Map
3njeA	1	0.9293	24.8	0.846	Contact Map
2retB	2	0.9596	16.3	0.858	Contact Map
4xohC	2	0.3131	4.4	0.89	Contact Map
2xcmC	1	0.7778	3.3	0.897	Contact Map
2kmwA	1	0.7778	2.6	0.903	Contact Map
2zd7A	2	0.8788	2.5	0.903	Contact Map
4uuyA	2	0.8283	2.3	0.905	Contact Map
1ejfA	1	0.7677	2.1	0.908	Contact Map
3opbA	2	0.2626	1.9	0.91	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.