FidL_like - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FidL_like - FidL-like putative membrane protein

PFAM:	PF15941	Sequences: GTVTSNGKKYIISRTIYFTYERKDDGGTYRLTITKIIKSPNDNVPDEIFNKLLFFSTPGKSRYLKIKKLNDNAYLISNLYSPLFIC	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	86 (86)
Sequences:	525 (411)
Seq/√Len:	44.4
META:	0.451

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
38_K	46_D	4.403	1.00
76_I	84_F	4.102	1.00
10_Y	45_P	2.863	1.00
14_R	42_D	2.686	1.00
45_P	48_I	2.656	1.00
20_Y	82_P	2.348	1.00
2_T	9_K	2.222	1.00
10_Y	44_V	2.107	1.00
11_I	43_N	1.964	0.99
70_N	73_A	1.904	0.99
82_P	86_C	1.813	0.98
13_S	78_N	1.776	0.98
61_S	74_Y	1.750	0.98
19_T	34_T	1.648	0.97
78_N	81_S	1.636	0.97
47_E	71_D	1.530	0.96
36_I	85_I	1.453	0.94
38_K	42_D	1.432	0.94
35_K	46_D	1.408	0.93
26_G	67_K	1.345	0.91
5_S	46_D	1.302	0.90
25_D	66_I	1.279	0.89
29_Y	68_K	1.277	0.89
30_R	61_S	1.216	0.87
1_G	4_T	1.215	0.87
14_R	38_K	1.213	0.87
4_T	7_G	1.192	0.86
26_G	66_I	1.155	0.84
12_I	64_L	1.139	0.83
14_R	66_I	1.128	0.82
47_E	51_K	1.127	0.82
62_R	78_N	1.126	0.82
52_L	55_F	1.108	0.81
49_F	53_L	1.099	0.81
43_N	68_K	1.098	0.80
18_F	25_D	1.089	0.80
43_N	58_P	1.068	0.79
28_T	64_L	1.065	0.78
62_R	81_S	1.065	0.78
12_I	41_N	1.063	0.78
12_I	75_L	1.032	0.76
62_R	80_Y	1.029	0.76
5_S	76_I	1.016	0.75
3_V	34_T	1.003	0.74
20_Y	70_N	1.000	0.74
13_S	37_I	0.969	0.71
13_S	63_Y	0.954	0.70
20_Y	29_Y	0.937	0.69
9_K	19_T	0.937	0.69
8_K	11_I	0.935	0.69
33_I	54_F	0.921	0.68
15_T	41_N	0.903	0.66
52_L	78_N	0.899	0.66
31_L	55_F	0.885	0.64
24_D	28_T	0.884	0.64
76_I	83_L	0.883	0.64
22_R	36_I	0.876	0.64
15_T	37_I	0.870	0.63
8_K	22_R	0.856	0.62
11_I	32_T	0.851	0.61
18_F	53_L	0.833	0.60
32_T	72_N	0.815	0.58
40_P	78_N	0.807	0.57
18_F	79_L	0.804	0.57
25_D	44_V	0.799	0.56
33_I	56_S	0.791	0.56
12_I	78_N	0.783	0.55
17_Y	29_Y	0.781	0.55
65_K	82_P	0.777	0.54
12_I	29_Y	0.775	0.54
3_V	9_K	0.774	0.54
12_I	45_P	0.760	0.53
56_S	59_G	0.755	0.52
31_L	82_P	0.752	0.52
7_G	17_Y	0.737	0.51
7_G	71_D	0.737	0.51
29_Y	67_K	0.734	0.50
16_I	20_Y	0.726	0.49
77_S	81_S	0.713	0.48
27_G	76_I	0.710	0.48
64_L	83_L	0.709	0.48
31_L	77_S	0.709	0.48
73_A	80_Y	0.707	0.48
25_D	31_L	0.702	0.47
33_I	79_L	0.691	0.46
51_K	85_I	0.679	0.45
36_I	46_D	0.678	0.45
32_T	37_I	0.671	0.44
24_D	27_G	0.669	0.44
11_I	70_N	0.663	0.43
24_D	32_T	0.655	0.43
42_D	75_L	0.636	0.41
27_G	37_I	0.632	0.40
20_Y	40_P	0.627	0.40
4_T	17_Y	0.626	0.40
37_I	43_N	0.625	0.40
13_S	81_S	0.621	0.39
68_K	71_D	0.612	0.39
20_Y	32_T	0.612	0.39
42_D	74_Y	0.607	0.38
5_S	8_K	0.599	0.37
25_D	75_L	0.598	0.37
49_F	55_F	0.594	0.37
6_N	45_P	0.592	0.37
63_Y	83_L	0.590	0.37
76_I	79_L	0.579	0.36
40_P	81_S	0.579	0.36
20_Y	84_F	0.577	0.35
65_K	77_S	0.574	0.35
31_L	76_I	0.564	0.34
61_S	64_L	0.563	0.34
18_F	82_P	0.554	0.33
4_T	9_K	0.553	0.33
37_I	69_L	0.545	0.33
2_T	5_S	0.534	0.32
13_S	41_N	0.533	0.32
47_E	68_K	0.524	0.31
3_V	7_G	0.523	0.31
33_I	75_L	0.522	0.31
11_I	46_D	0.520	0.31
82_P	85_I	0.519	0.31
12_I	39_S	0.517	0.30
10_Y	48_I	0.516	0.30
11_I	35_K	0.513	0.30
7_G	58_P	0.508	0.30
1_G	10_Y	0.508	0.30
13_S	22_R	0.502	0.29
55_F	62_R	0.500	0.29
32_T	46_D	0.500	0.29

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4dx8H	1	0.5116	3.9	0.886	Contact Map
1lurA	1	0.9651	3.3	0.89	Contact Map
3n8bA	2	0.7907	3.3	0.89	Contact Map
1xcrA	1	0.7326	2.8	0.894	Contact Map
4orlA	1	0.407	2.4	0.898	Contact Map
4cfeA	1	0.7326	2.3	0.899	Contact Map
3vwcA	1	0.6977	2.3	0.899	Contact Map
4enzA	1	0.8721	2.2	0.9	Contact Map
2l0cA	1	0.3372	2.2	0.9	Contact Map
1nsxA	2	0.9767	2	0.901	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.