BAT - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

BAT - GAF and HTH_10 associated domain

PFAM:	PF15915	Sequences: DTVVELEFRVTDPDFPLVRLAAALDCTVELEGVVPRGDGTVLPYFTVTGADPEAVEAAAEDDPGVEDVRLVDEGDDEGLFELTVTGPSLLSTLAEHGATVRSATATDGGWRLVVELPDRADVREFVEALRERYPDVELVAKRERERPVRTRQEFRA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	156 (147)
Sequences:	3483 (2795)
Seq/√Len:	230.5
META:	0.655

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
45_F	82_L	4.791	1.00
98_A	116_L	4.140	1.00
93_L	98_A	3.922	1.00
101_R	115_E	3.115	1.00
9_R	109_G	2.720	1.00
30_L	33_V	2.502	1.00
8_F	126_V	2.442	1.00
70_L	80_F	2.386	1.00
21_A	108_G	2.290	1.00
56_E	68_V	2.214	1.00
31_E	79_L	2.151	1.00
31_E	46_T	2.151	1.00
52_P	78_G	2.127	1.00
47_V	55_V	2.100	1.00
51_D	54_A	1.992	1.00
129_L	136_V	1.934	1.00
9_R	139_V	1.913	1.00
138_L	141_K	1.840	1.00
18_V	110_W	1.838	1.00
70_L	78_G	1.836	1.00
96_H	128_A	1.810	1.00
122_V	141_K	1.805	1.00
103_A	112_L	1.766	1.00
56_E	80_F	1.763	1.00
7_E	111_R	1.681	1.00
118_D	121_D	1.635	1.00
54_A	57_A	1.600	1.00
100_V	103_A	1.592	1.00
7_E	142_R	1.582	1.00
74_G	77_E	1.580	1.00
43_P	84_V	1.578	1.00
69_R	81_E	1.565	1.00
8_F	129_L	1.553	1.00
59_A	68_V	1.547	1.00
105_A	110_W	1.505	1.00
23_A	58_A	1.484	1.00
106_T	109_G	1.364	1.00
55_V	80_F	1.350	1.00
29_E	48_T	1.349	1.00
56_E	60_E	1.333	1.00
46_T	79_L	1.331	1.00
30_L	103_A	1.329	1.00
30_L	43_P	1.313	1.00
3_V	146_R	1.289	1.00
10_V	136_V	1.259	1.00
27_T	48_T	1.254	1.00
46_T	77_E	1.240	1.00
129_L	134_P	1.226	1.00
42_L	83_T	1.218	1.00
92_T	96_H	1.199	1.00
121_D	124_E	1.183	1.00
9_R	137_E	1.181	1.00
8_F	114_V	1.177	1.00
28_V	82_L	1.154	1.00
19_R	23_A	1.141	1.00
33_V	43_P	1.103	1.00
100_V	114_V	1.101	1.00
123_R	127_E	1.100	1.00
128_A	132_R	1.094	1.00
88_S	91_S	1.083	1.00
30_L	44_Y	1.072	1.00
93_L	114_V	1.068	1.00
70_L	73_E	1.065	1.00
53_E	56_E	1.051	1.00
91_S	95_E	1.048	1.00
12_D	18_V	1.043	1.00
26_C	49_G	1.030	1.00
92_T	128_A	1.028	1.00
114_V	117_P	1.024	1.00
57_A	60_E	1.017	1.00
7_E	113_V	1.012	1.00
27_T	106_T	1.008	1.00
21_A	107_D	1.005	1.00
102_S	113_V	1.004	1.00
52_P	56_E	1.003	1.00
59_A	65_V	0.996	1.00
45_F	80_F	0.995	1.00
29_E	104_T	0.952	1.00
26_C	105_A	0.952	1.00
127_E	131_E	0.946	1.00
7_E	140_A	0.945	1.00
19_R	62_D	0.940	1.00
40_T	83_T	0.940	1.00
94_A	97_G	0.936	1.00
21_A	24_L	0.936	1.00
66_E	83_T	0.926	1.00
66_E	85_T	0.922	1.00
48_T	77_E	0.922	1.00
145_E	148_V	0.922	1.00
90_L	100_V	0.920	1.00
20_L	59_A	0.917	1.00
12_D	15_F	0.906	0.99
57_A	61_D	0.887	0.99
115_E	146_R	0.876	0.99
115_E	144_R	0.875	0.99
27_T	104_T	0.867	0.99
36_R	88_S	0.861	0.99
51_D	120_A	0.855	0.99
3_V	144_R	0.855	0.99
43_P	114_V	0.848	0.99
67_D	83_T	0.839	0.99
5_E	113_V	0.839	0.99
139_V	149_R	0.837	0.99
64_G	85_T	0.829	0.99
59_A	64_G	0.804	0.99
20_L	58_A	0.804	0.99
4_V	138_L	0.798	0.99
13_P	16_P	0.797	0.99
108_G	127_E	0.790	0.99
5_E	140_A	0.789	0.99
19_R	22_A	0.788	0.99
143_E	147_P	0.772	0.98
65_V	68_V	0.751	0.98
129_L	133_Y	0.750	0.98
111_R	139_V	0.736	0.98
62_D	65_V	0.733	0.98
71_V	79_L	0.730	0.98
90_L	103_A	0.728	0.98
50_A	55_V	0.725	0.98
54_A	58_A	0.725	0.98
4_V	13_P	0.721	0.97
44_Y	71_V	0.720	0.97
56_E	70_L	0.719	0.97
126_V	130_R	0.718	0.97
19_R	64_G	0.713	0.97
114_V	125_F	0.710	0.97
40_T	95_E	0.707	0.97
130_R	134_P	0.706	0.97
20_L	24_L	0.699	0.97
98_A	114_V	0.696	0.97
127_E	130_R	0.694	0.97
8_F	128_A	0.692	0.97
3_V	115_E	0.691	0.97
119_R	141_K	0.691	0.97
17_L	103_A	0.690	0.97
65_V	71_V	0.687	0.97
55_V	59_A	0.681	0.96
36_R	116_L	0.671	0.96
126_V	142_R	0.671	0.96
42_L	81_E	0.669	0.96
35_P	38_D	0.659	0.96
65_V	84_V	0.659	0.96
16_P	45_F	0.659	0.96
43_P	100_V	0.657	0.96
9_R	12_D	0.655	0.96
3_V	80_F	0.650	0.95
12_D	16_P	0.647	0.95
50_A	78_G	0.646	0.95
14_D	17_L	0.646	0.95
43_P	90_L	0.643	0.95
11_T	18_V	0.641	0.95
23_A	98_A	0.638	0.95
80_F	115_E	0.638	0.95
16_P	20_L	0.637	0.95
35_P	39_G	0.635	0.95
26_C	47_V	0.628	0.94
129_L	141_K	0.628	0.94
30_L	45_F	0.623	0.94
29_E	96_H	0.621	0.94
34_V	103_A	0.617	0.94
133_Y	141_K	0.615	0.94
89_L	112_L	0.612	0.94
95_E	131_E	0.610	0.94
15_F	18_V	0.610	0.94
103_A	110_W	0.608	0.93
15_F	89_L	0.603	0.93
119_R	130_R	0.601	0.93
36_R	131_E	0.600	0.93
43_P	47_V	0.599	0.93
16_P	36_R	0.596	0.93
26_C	88_S	0.596	0.93
123_R	130_R	0.595	0.93
69_R	90_L	0.593	0.93
68_V	82_L	0.592	0.93
6_L	138_L	0.589	0.92
52_P	80_F	0.589	0.92
23_A	26_C	0.588	0.92
17_L	84_V	0.583	0.92
104_T	111_R	0.581	0.92
97_G	123_R	0.579	0.92
42_L	103_A	0.578	0.92
10_V	17_L	0.578	0.92
53_E	57_A	0.571	0.91
128_A	131_E	0.568	0.91
67_D	121_D	0.568	0.91
56_E	59_A	0.565	0.91
15_F	115_E	0.565	0.91
11_T	135_D	0.563	0.91
13_P	29_E	0.557	0.90
119_R	139_V	0.556	0.90
99_T	115_E	0.553	0.90
32_G	41_V	0.552	0.90
116_L	125_F	0.552	0.90
33_V	96_H	0.550	0.90
8_F	138_L	0.550	0.90
47_V	78_G	0.549	0.90
78_G	121_D	0.548	0.89
75_D	148_V	0.547	0.89
17_L	20_L	0.547	0.89
41_V	68_V	0.546	0.89
88_S	97_G	0.542	0.89
15_F	110_W	0.541	0.89
18_V	108_G	0.536	0.88
101_R	113_V	0.535	0.88
24_L	58_A	0.529	0.88
21_A	26_C	0.525	0.87
94_A	100_V	0.524	0.87
28_V	105_A	0.523	0.87
46_T	82_L	0.521	0.87
46_T	141_K	0.518	0.87
83_T	89_L	0.515	0.86
44_Y	81_E	0.513	0.86
23_A	49_G	0.512	0.86
81_E	117_P	0.509	0.86
8_F	136_V	0.508	0.86
77_E	85_T	0.508	0.86
131_E	149_R	0.504	0.85
98_A	107_D	0.504	0.85
74_G	100_V	0.501	0.85
29_E	41_V	0.500	0.85

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4pwuA	4	0.5064	7.7	0.914	Contact Map
1zpvA	3	0.4936	4.9	0.922	Contact Map
2lvwA	2	0.5321	4.6	0.923	Contact Map
2w7vA	2	0.4936	4.6	0.923	Contact Map
2ko1A	2	0.5192	4.5	0.923	Contact Map
1u8sA	2	0.9295	4.4	0.923	Contact Map
2nyiA	2	0.891	4.1	0.925	Contact Map
3mtjA	3	0.5	3.9	0.926	Contact Map
2l26A	1	0.3974	3.8	0.926	Contact Map
3s30A	1	0	3.8	0.926	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.