MBF2 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MBF2 - Transcription activator MBF2

PFAM:	PF15868	Sequences: WGSRGPGDRLLYRENVVKSSSFLRVVTVTVTYPVNNETITAIEALDQKTDGNGGYASIVSGGVGYNFVTIRLKSQRGRGFNFTVEIYG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	88 (87)
Sequences:	528 (426)
Seq/√Len:	45.6
META:	0.188

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
11_L	88_G	4.474	1.00
58_I	68_V	3.721	1.00
43_E	85_E	3.192	1.00
56_A	70_I	3.095	1.00
72_L	84_V	2.901	1.00
29_T	71_R	2.826	1.00
54_G	82_F	2.433	1.00
13_R	85_E	2.424	1.00
4_R	8_D	2.079	1.00
4_R	7_G	1.913	0.99
54_G	80_F	1.838	0.99
47_Q	83_T	1.728	0.98
32_Y	86_I	1.656	0.98
42_I	68_V	1.651	0.97
46_D	53_G	1.647	0.97
17_V	81_N	1.642	0.97
70_I	86_I	1.592	0.97
30_V	84_V	1.567	0.96
4_R	40_T	1.547	0.96
44_A	82_F	1.538	0.96
25_V	76_R	1.514	0.96
10_L	85_E	1.432	0.94
39_I	86_I	1.423	0.94
15_N	81_N	1.354	0.92
31_T	69_T	1.270	0.90
74_S	79_G	1.250	0.89
60_S	67_F	1.208	0.87
4_R	43_E	1.157	0.85
4_R	41_A	1.135	0.84
45_L	85_E	1.130	0.83
46_D	73_K	1.121	0.83
44_A	71_R	1.121	0.83
19_S	22_F	1.120	0.83
10_L	19_S	1.111	0.82
37_E	66_N	1.093	0.81
3_S	6_P	1.083	0.81
30_V	33_P	1.062	0.79
43_E	55_Y	1.058	0.79
29_T	69_T	1.048	0.78
39_I	53_G	1.038	0.78
62_G	68_V	1.009	0.76
12_Y	15_N	0.983	0.74
31_T	73_K	0.954	0.71
16_V	72_L	0.951	0.71
56_A	72_L	0.942	0.70
9_R	29_T	0.934	0.70
48_K	52_N	0.930	0.69
46_D	74_S	0.914	0.68
37_E	88_G	0.906	0.67
73_K	76_R	0.876	0.65
57_S	73_K	0.869	0.64
50_D	75_Q	0.862	0.64
48_K	79_G	0.815	0.59
57_S	71_R	0.814	0.59
19_S	24_R	0.798	0.58
9_R	85_E	0.795	0.57
6_P	14_E	0.795	0.57
10_L	18_K	0.781	0.56
55_Y	75_Q	0.781	0.56
62_G	82_F	0.767	0.55
21_S	24_R	0.765	0.54
54_G	74_S	0.756	0.53
20_S	23_L	0.748	0.53
8_D	18_K	0.747	0.53
37_E	60_S	0.734	0.51
23_L	26_V	0.732	0.51
13_R	55_Y	0.726	0.51
48_K	84_V	0.722	0.50
40_T	63_V	0.720	0.50
12_Y	44_A	0.718	0.50
56_A	86_I	0.713	0.49
58_I	61_G	0.711	0.49
38_T	42_I	0.704	0.48
17_V	78_R	0.702	0.48
56_A	76_R	0.701	0.48
28_V	33_P	0.694	0.47
46_D	54_G	0.687	0.47
10_L	13_R	0.687	0.47
11_L	86_I	0.685	0.47
52_N	75_Q	0.685	0.47
40_T	43_E	0.669	0.45
53_G	71_R	0.669	0.45
54_G	86_I	0.666	0.45
18_K	78_R	0.664	0.44
30_V	34_V	0.654	0.44
32_Y	65_Y	0.654	0.44
68_V	86_I	0.652	0.43
53_G	82_F	0.651	0.43
49_T	66_N	0.650	0.43
30_V	36_N	0.641	0.42
12_Y	17_V	0.635	0.42
42_I	74_S	0.630	0.41
41_A	63_V	0.623	0.41
58_I	83_T	0.622	0.40
36_N	64_G	0.619	0.40
15_N	18_K	0.617	0.40
75_Q	88_G	0.610	0.39
19_S	63_V	0.607	0.39
82_F	86_I	0.605	0.39
62_G	88_G	0.603	0.39
24_R	76_R	0.598	0.38
73_K	84_V	0.595	0.38
18_K	21_S	0.587	0.37
8_D	40_T	0.580	0.37
61_G	68_V	0.577	0.36
25_V	71_R	0.569	0.36
2_G	41_A	0.568	0.35
39_I	67_F	0.567	0.35
42_I	64_G	0.567	0.35
20_S	48_K	0.561	0.35
25_V	65_Y	0.558	0.35
71_R	76_R	0.555	0.34
75_Q	82_F	0.546	0.34
58_I	63_V	0.541	0.33
31_T	38_T	0.533	0.32
8_D	88_G	0.530	0.32
3_S	65_Y	0.528	0.32
19_S	38_T	0.523	0.32
25_V	77_G	0.521	0.31
7_G	56_A	0.521	0.31
22_F	74_S	0.520	0.31
40_T	72_L	0.519	0.31
48_K	82_F	0.519	0.31
7_G	87_Y	0.517	0.31
21_S	56_A	0.515	0.31
23_L	77_G	0.515	0.31
2_G	40_T	0.511	0.31
39_I	79_G	0.510	0.30
49_T	63_V	0.500	0.30
42_I	70_I	0.500	0.30

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2qqmA	1	0.9773	19.1	0.865	Contact Map
2wuhA	1	1	14.6	0.872	Contact Map
4ag4A	1	1	14.2	0.873	Contact Map
4a4aA	1	0.9091	14.1	0.873	Contact Map
2qqoA	1	0.9886	13.4	0.874	Contact Map
2qqjA	1	0.9773	13.3	0.875	Contact Map
4gz9A	2	0.9773	11.3	0.878	Contact Map
2qqkA	1	0.9432	11.2	0.879	Contact Map
1k12A	1	0.9545	11	0.879	Contact Map
2qqiA	1	0.9773	10.9	0.879	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.