Tox-REase-7 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Tox-REase-7 - Restriction endonuclease fold toxin 7

PFAM:	PF15649	Sequences: GRAGEAAAGIGDIGNKKRITVPSLTGTARYRIPDGLTDTAKTLTEVKNVKYLSLTRQLRDFAAYAQQNGLTFELYVRPNTKLSGPL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	86 (82)
Sequences:	874 (811)
Seq/√Len:	89.5
META:	0.896

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
31_R	60_D	4.532	1.00
35_G	44_T	3.903	1.00
49_V	52_L	3.776	1.00
54_L	62_A	2.817	1.00
18_R	30_Y	2.428	1.00
31_R	61_F	2.260	1.00
63_A	67_Q	2.092	1.00
44_T	75_Y	2.090	1.00
32_I	61_F	1.857	1.00
4_G	48_N	1.606	1.00
29_R	60_D	1.588	1.00
42_T	73_E	1.586	1.00
64_Y	68_N	1.538	1.00
41_K	70_L	1.532	1.00
19_I	33_P	1.526	1.00
76_V	80_T	1.495	1.00
36_L	64_Y	1.476	1.00
64_Y	70_L	1.472	1.00
15_N	18_R	1.440	0.99
15_N	19_I	1.411	0.99
50_K	79_N	1.384	0.99
16_K	19_I	1.303	0.99
44_T	73_E	1.258	0.98
56_R	59_R	1.250	0.98
37_T	42_T	1.243	0.98
37_T	70_L	1.234	0.98
43_L	61_F	1.228	0.98
23_S	28_A	1.203	0.98
17_K	38_D	1.178	0.98
14_G	17_K	1.171	0.97
43_L	65_A	1.166	0.97
2_R	6_A	1.153	0.97
25_T	63_A	1.144	0.97
77_R	80_T	1.115	0.97
14_G	18_R	1.093	0.96
9_G	13_I	1.081	0.96
25_T	28_A	1.076	0.96
53_S	56_R	1.071	0.96
24_L	28_A	1.046	0.95
54_L	59_R	1.040	0.95
1_G	5_E	1.038	0.95
18_R	32_I	1.029	0.95
51_Y	81_K	1.014	0.94
8_A	11_G	1.014	0.94
42_T	71_T	0.974	0.93
8_A	13_I	0.965	0.93
54_L	85_P	0.961	0.92
3_A	7_A	0.959	0.92
48_N	77_R	0.948	0.92
58_L	61_F	0.940	0.92
33_P	36_L	0.938	0.92
53_S	85_P	0.900	0.90
63_A	66_Q	0.891	0.89
46_V	75_Y	0.888	0.89
38_D	70_L	0.862	0.88
19_I	64_Y	0.857	0.87
23_S	27_T	0.839	0.86
4_G	46_V	0.826	0.85
22_P	25_T	0.805	0.84
50_K	77_R	0.760	0.80
19_I	36_L	0.758	0.80
43_L	70_L	0.742	0.79
59_R	83_S	0.742	0.79
39_T	42_T	0.740	0.78
43_L	72_F	0.724	0.77
38_D	64_Y	0.724	0.77
13_I	35_G	0.722	0.77
52_L	82_L	0.716	0.76
42_T	70_L	0.713	0.76
11_G	15_N	0.709	0.75
8_A	35_G	0.700	0.75
24_L	63_A	0.696	0.74
8_A	44_T	0.693	0.74
6_A	66_Q	0.682	0.73
51_Y	83_S	0.682	0.73
61_F	72_F	0.680	0.72
4_G	7_A	0.675	0.72
81_K	84_G	0.675	0.72
8_A	15_N	0.673	0.72
12_D	15_N	0.672	0.72
4_G	77_R	0.672	0.72
28_A	60_D	0.653	0.69
5_E	14_G	0.650	0.69
30_Y	56_R	0.645	0.68
22_P	27_T	0.635	0.67
27_T	56_R	0.633	0.67
62_A	73_E	0.629	0.66
10_I	14_G	0.628	0.66
35_G	75_Y	0.622	0.66
51_Y	56_R	0.621	0.65
37_T	41_K	0.620	0.65
8_A	12_D	0.619	0.65
9_G	46_V	0.616	0.65
58_L	66_Q	0.613	0.64
9_G	12_D	0.606	0.64
36_L	70_L	0.595	0.62
55_T	80_T	0.592	0.62
35_G	73_E	0.590	0.62
76_V	82_L	0.578	0.60
24_L	27_T	0.572	0.59
42_T	75_Y	0.567	0.59
25_T	29_R	0.566	0.58
65_A	72_F	0.563	0.58
37_T	74_L	0.561	0.58
66_Q	76_V	0.557	0.57
53_S	83_S	0.555	0.57
43_L	62_A	0.548	0.56
37_T	68_N	0.544	0.55
74_L	82_L	0.541	0.55
36_L	44_T	0.534	0.54
54_L	72_F	0.534	0.54
49_V	77_R	0.532	0.54
78_P	84_G	0.526	0.53
55_T	58_L	0.518	0.52
53_S	59_R	0.515	0.51
12_D	35_G	0.515	0.51
31_R	72_F	0.514	0.51
58_L	72_F	0.512	0.51
33_P	61_F	0.508	0.51
27_T	63_A	0.507	0.50
71_T	75_Y	0.503	0.50
31_R	58_L	0.501	0.50
58_L	74_L	0.500	0.49

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1t0fA	2	1	16.4	0.886	Contact Map
3k93A	3	0.9884	13.9	0.89	Contact Map
1m0dA	2	0.9419	13.1	0.891	Contact Map
2wcwA	2	0.9651	9.8	0.897	Contact Map
3sm4A	3	0.9535	9.6	0.898	Contact Map
4k05A	2	0.9535	9.3	0.898	Contact Map
1ou9A	4	0.4767	8.4	0.9	Contact Map
3syyA	3	0.9767	7.3	0.903	Contact Map
3j65o	1	0	7	0.903	Contact Map
1gefA	2	0.907	6.9	0.904	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0044 seconds.