Tox-REase-5 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Tox-REase-5 - Restriction endonuclease fold toxin 5

PFAM:	PF15648	Sequences: ARAYQEQITGAPRGTEYRVWIPEWKVNGVKFDGFDPSDGVLLEAKPGYDQFFDKDGEFKPWFKGADKLLDQARRQLAAARAGGPPARIEWHFAEP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	95 (90)
Sequences:	908 (757)
Seq/√Len:	79.8
META:	0.7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
43_E	71_Q	3.198	1.00
42_L	91_H	3.190	1.00
46_P	93_A	3.117	1.00
35_D	38_D	3.056	1.00
49_D	94_E	2.862	1.00
70_D	74_R	2.605	1.00
6_E	13_R	2.377	1.00
4_Y	8_I	2.331	1.00
51_F	64_G	2.307	1.00
75_Q	90_W	2.253	1.00
29_V	78_A	1.969	1.00
27_N	78_A	1.933	1.00
34_F	84_P	1.810	1.00
35_D	42_L	1.718	1.00
52_F	58_F	1.605	1.00
53_D	56_G	1.580	1.00
29_V	74_R	1.564	1.00
40_V	89_E	1.552	0.99
11_A	14_G	1.546	0.99
8_I	91_H	1.435	0.99
11_A	15_T	1.431	0.99
65_A	68_L	1.414	0.99
73_R	77_A	1.403	0.99
59_K	62_F	1.374	0.99
47_G	94_E	1.339	0.98
6_E	11_A	1.308	0.98
21_I	24_W	1.272	0.98
17_Y	34_F	1.268	0.98
33_G	42_L	1.263	0.98
13_R	16_E	1.239	0.97
70_D	73_R	1.235	0.97
43_E	88_I	1.212	0.97
46_P	50_Q	1.163	0.96
69_L	72_A	1.150	0.96
34_F	41_L	1.126	0.96
53_D	57_E	1.116	0.95
34_F	39_G	1.087	0.95
7_Q	93_A	1.086	0.95
4_Y	91_H	1.040	0.93
2_R	15_T	1.035	0.93
9_T	33_G	1.035	0.93
9_T	42_L	1.027	0.93
38_D	89_E	1.023	0.93
2_R	6_E	1.020	0.92
54_K	57_E	1.018	0.92
58_F	62_F	0.990	0.91
58_F	64_G	0.953	0.90
6_E	12_P	0.952	0.90
68_L	92_F	0.951	0.90
2_R	13_R	0.950	0.90
33_G	44_A	0.946	0.89
82_G	85_P	0.944	0.89
41_L	79_A	0.921	0.88
47_G	93_A	0.919	0.88
89_E	92_F	0.919	0.88
47_G	50_Q	0.914	0.88
66_D	70_D	0.912	0.88
74_R	78_A	0.894	0.86
35_D	39_G	0.881	0.86
2_R	11_A	0.877	0.85
2_R	12_P	0.833	0.82
26_V	31_F	0.810	0.81
51_F	62_F	0.802	0.80
52_F	65_A	0.801	0.80
52_F	56_G	0.795	0.79
64_G	68_L	0.784	0.78
48_Y	51_F	0.780	0.78
12_P	15_T	0.774	0.77
11_A	34_F	0.774	0.77
19_V	22_P	0.769	0.77
49_D	68_L	0.751	0.75
41_L	68_L	0.742	0.74
60_P	64_G	0.739	0.74
4_Y	33_G	0.726	0.73
63_K	67_K	0.718	0.72
63_K	66_D	0.717	0.72
4_Y	15_T	0.716	0.72
70_D	77_A	0.714	0.72
79_A	88_I	0.712	0.71
76_L	88_I	0.702	0.70
8_I	42_L	0.697	0.70
12_P	34_F	0.689	0.69
34_F	76_L	0.688	0.69
69_L	77_A	0.683	0.68
3_A	6_E	0.677	0.68
75_Q	88_I	0.670	0.67
31_F	75_Q	0.663	0.66
8_I	44_A	0.662	0.66
4_Y	7_Q	0.661	0.66
46_P	94_E	0.656	0.65
82_G	88_I	0.641	0.63
59_K	63_K	0.636	0.63
7_Q	33_G	0.634	0.62
75_Q	78_A	0.627	0.62
69_L	73_R	0.625	0.61
61_W	76_L	0.619	0.61
44_A	91_H	0.618	0.60
26_V	41_L	0.615	0.60
35_D	40_V	0.612	0.60
49_D	54_K	0.607	0.59
20_W	24_W	0.602	0.58
73_R	76_L	0.601	0.58
16_E	71_Q	0.596	0.58
45_K	75_Q	0.594	0.57
50_Q	62_F	0.587	0.57
65_A	69_L	0.587	0.57
25_K	30_K	0.586	0.56
41_L	85_P	0.585	0.56
24_W	28_G	0.585	0.56
48_Y	68_L	0.583	0.56
39_G	43_E	0.570	0.54
50_Q	64_G	0.569	0.54
44_A	89_E	0.564	0.54
76_L	89_E	0.561	0.53
20_W	23_E	0.559	0.53
7_Q	31_F	0.552	0.52
77_A	80_R	0.552	0.52
23_E	28_G	0.548	0.52
3_A	13_R	0.543	0.51
66_D	82_G	0.537	0.50
60_P	63_K	0.537	0.50
39_G	84_P	0.534	0.50
19_V	29_V	0.533	0.50
54_K	61_W	0.528	0.49
58_F	61_W	0.527	0.49
57_E	61_W	0.527	0.49
14_G	17_Y	0.523	0.48
31_F	56_G	0.522	0.48
61_W	65_A	0.516	0.47
17_Y	41_L	0.513	0.47
48_Y	64_G	0.512	0.47
35_D	91_H	0.506	0.46
51_F	65_A	0.506	0.46
7_Q	43_E	0.500	0.45
3_A	14_G	0.500	0.45

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3wnoA	2	0.9368	13	0.91	Contact Map
3syyA	3	0.9158	10	0.914	Contact Map
2w45A	1	0.9053	9.6	0.915	Contact Map
3sm4A	3	0.9158	9.4	0.915	Contact Map
3k93A	3	0.8947	7.3	0.919	Contact Map
4d3tA	2	0.5684	6.3	0.922	Contact Map
3ljwA	1	0.4	4.7	0.926	Contact Map
2qnkA	1	0.5368	3.9	0.929	Contact Map
1mjtA	2	0.5474	3.6	0.93	Contact Map
3q2uA	1	0.4632	2.4	0.937	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.