Imm-NTF2-2 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Imm-NTF2-2 - NTF2 fold immunity protein

PFAM:	PF15631	Sequences: TAIKIAEAVLIPIYGKEQIESEKPFKATLKDGSVWTVEGTLPKGSLPTCKGGVAEIEISKKDGRILRVTHGK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	72 (67)
Sequences:	2794 (2264)
Seq/√Len:	276.6
META:	0.964

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
22_E	54_A	3.166	1.00
59_S	62_D	2.609	1.00
7_E	23_K	2.498	1.00
29_L	60_K	2.353	1.00
57_E	67_R	2.206	1.00
59_S	64_R	2.024	1.00
34_V	57_E	1.935	1.00
41_L	53_V	1.929	1.00
53_V	71_G	1.837	1.00
13_I	68_V	1.827	1.00
10_L	56_I	1.794	1.00
4_K	11_I	1.716	1.00
36_T	57_E	1.694	1.00
8_A	12_P	1.666	1.00
16_K	20_E	1.607	1.00
20_E	23_K	1.530	1.00
38_E	55_E	1.518	1.00
28_T	38_E	1.410	1.00
10_L	54_A	1.399	1.00
55_E	69_T	1.381	1.00
36_T	55_E	1.330	1.00
26_K	38_E	1.320	1.00
42_P	45_S	1.287	1.00
7_E	11_I	1.273	1.00
55_E	67_R	1.258	1.00
3_I	27_A	1.249	1.00
1_T	8_A	1.201	1.00
24_P	39_G	1.199	1.00
4_K	7_E	1.177	1.00
34_V	66_L	1.109	1.00
43_K	46_L	1.104	1.00
55_E	71_G	1.055	1.00
30_K	36_T	1.012	1.00
18_Q	22_E	1.011	1.00
26_K	40_T	0.999	1.00
5_I	58_I	0.998	1.00
11_I	16_K	0.970	1.00
6_A	10_L	0.958	1.00
27_A	37_V	0.916	1.00
25_F	54_A	0.913	1.00
11_I	19_I	0.897	1.00
9_V	63_G	0.897	1.00
29_L	32_G	0.892	1.00
11_I	20_E	0.891	1.00
32_G	61_K	0.889	1.00
29_L	34_V	0.870	1.00
42_P	46_L	0.845	1.00
5_I	9_V	0.824	0.99
18_Q	21_S	0.790	0.99
28_T	36_T	0.778	0.99
40_T	43_K	0.773	0.99
5_I	8_A	0.762	0.99
54_A	70_H	0.755	0.99
1_T	12_P	0.738	0.99
1_T	5_I	0.725	0.99
9_V	13_I	0.718	0.99
39_G	53_V	0.718	0.99
7_E	25_F	0.703	0.98
7_E	24_P	0.703	0.98
15_G	19_I	0.701	0.98
25_F	35_W	0.694	0.98
29_L	35_W	0.692	0.98
2_A	63_G	0.684	0.98
30_K	34_V	0.676	0.98
7_E	19_I	0.675	0.98
52_G	70_H	0.674	0.98
10_L	19_I	0.667	0.98
4_K	16_K	0.650	0.97
3_I	40_T	0.638	0.97
41_L	44_G	0.634	0.97
4_K	8_A	0.634	0.97
57_E	69_T	0.634	0.97
59_S	66_L	0.625	0.97
24_P	40_T	0.624	0.97
32_G	60_K	0.618	0.96
20_E	37_V	0.611	0.96
10_L	25_F	0.610	0.96
32_G	59_S	0.609	0.96
11_I	25_F	0.609	0.96
30_K	57_E	0.596	0.96
3_I	7_E	0.595	0.96
2_A	6_A	0.595	0.96
19_I	54_A	0.593	0.95
27_A	35_W	0.585	0.95
9_V	56_I	0.563	0.94
22_E	39_G	0.553	0.93
9_V	65_I	0.550	0.93
56_I	68_V	0.547	0.93
9_V	12_P	0.542	0.93
5_I	65_I	0.534	0.92
22_E	70_H	0.533	0.92
19_I	25_F	0.530	0.92
22_E	53_V	0.530	0.92
41_L	51_G	0.528	0.92
5_I	12_P	0.524	0.92
38_E	71_G	0.521	0.91
23_K	54_A	0.509	0.90
60_K	63_G	0.506	0.90
4_K	63_G	0.500	0.90
14_Y	72_K	0.500	0.90

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4k90B	1	0.9306	33	0.828	Contact Map
4exrA	2	0.8194	25.2	0.837	Contact Map
2hi1A	2	0.8889	9.6	0.866	Contact Map
3nqzA	1	0.8611	8.2	0.87	Contact Map
2gu3A	1	0.8611	5.8	0.879	Contact Map
3c0fB	2	0.7917	5.2	0.881	Contact Map
1w36B	1	0.8889	4.8	0.883	Contact Map
4xchA	4	0.3333	3.7	0.889	Contact Map
1vm6A	4	0.6111	3.5	0.89	Contact Map
2rdyA	2	0.8194	3.2	0.893	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0043 seconds.