TerY_C - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TerY_C - TerY-C metal binding domain

PFAM:	PF15616	Sequences: DENFVVLLGKCQKTKKPYLIKYEKRLQESGFGDLGLNTRDYRLVGAFPVDESYFELSDGSANNLKINTSELIGAPGCPHCGNQFGFAVCSCGKIHCIGGEGEATCPWCGNTGTYGAGGEGGFDVNRGRG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	129 (128)
Sequences:	604 (493)
Seq/√Len:	43.5
META:	0.856

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
95_H	114_Y	4.457	1.00
93_K	107_W	3.675	1.00
10_K	107_W	3.176	1.00
54_F	107_W	2.753	1.00
85_G	89_C	2.744	1.00
10_K	51_E	2.618	1.00
15_K	109_G	2.494	1.00
86_F	124_V	2.483	1.00
102_E	111_T	2.436	1.00
104_T	111_T	2.225	1.00
20_I	75_P	2.201	1.00
17_P	54_F	2.144	1.00
29_S	32_G	2.081	0.99
126_R	129_G	2.041	0.99
109_G	112_G	1.961	0.99
95_H	103_A	1.777	0.98
101_G	113_T	1.762	0.98
43_L	86_F	1.721	0.98
87_A	97_I	1.668	0.97
87_A	122_F	1.666	0.97
3_N	6_V	1.635	0.97
8_L	17_P	1.586	0.96
29_S	33_D	1.573	0.96
16_K	79_H	1.538	0.96
105_C	108_C	1.535	0.95
65_K	123_D	1.532	0.95
87_A	114_Y	1.512	0.95
27_Q	30_G	1.504	0.95
8_L	127_G	1.450	0.94
66_I	71_L	1.445	0.94
51_E	107_W	1.434	0.93
16_K	51_E	1.433	0.93
90_S	110_N	1.420	0.93
88_V	122_F	1.364	0.92
84_F	94_I	1.351	0.91
46_A	76_G	1.349	0.91
21_K	47_F	1.308	0.90
2_E	128_R	1.303	0.90
41_Y	55_E	1.300	0.90
85_G	88_V	1.299	0.90
13_K	42_R	1.277	0.89
43_L	56_L	1.270	0.88
118_G	121_G	1.236	0.87
69_S	121_G	1.230	0.87
12_Q	82_N	1.226	0.87
23_E	44_V	1.224	0.86
31_F	35_G	1.201	0.85
98_G	103_A	1.173	0.84
21_K	45_G	1.171	0.84
20_I	86_F	1.161	0.83
43_L	75_P	1.136	0.82
22_Y	74_A	1.125	0.81
17_P	51_E	1.118	0.81
9_G	75_P	1.087	0.79
16_K	50_D	1.075	0.78
2_E	95_H	1.069	0.78
66_I	125_N	1.063	0.78
95_H	112_G	1.049	0.77
97_I	100_E	1.048	0.77
22_Y	73_G	1.046	0.76
41_Y	54_F	1.032	0.75
28_E	31_F	1.020	0.75
117_G	120_G	1.020	0.75
23_E	79_H	1.019	0.74
2_E	39_R	1.014	0.74
48_P	79_H	1.003	0.73
28_E	33_D	0.991	0.72
34_L	63_N	0.967	0.71
19_L	22_Y	0.966	0.70
9_G	20_I	0.958	0.70
32_G	37_N	0.937	0.68
42_R	94_I	0.932	0.68
118_G	124_V	0.921	0.67
27_Q	33_D	0.915	0.66
10_K	52_S	0.914	0.66
18_Y	73_G	0.905	0.65
95_H	106_P	0.901	0.65
113_T	125_N	0.884	0.64
29_S	38_T	0.878	0.63
97_I	114_Y	0.868	0.62
45_G	81_G	0.864	0.62
78_P	96_C	0.858	0.61
77_C	80_C	0.840	0.60
23_E	76_G	0.838	0.59
7_L	94_I	0.821	0.58
24_K	73_G	0.807	0.56
77_C	105_C	0.807	0.56
45_G	53_Y	0.802	0.56
9_G	85_G	0.800	0.56
70_E	125_N	0.800	0.56
43_L	53_Y	0.799	0.56
48_P	89_C	0.794	0.55
11_C	18_Y	0.790	0.55
30_G	34_L	0.787	0.55
85_G	97_I	0.786	0.54
79_H	99_G	0.775	0.53
100_E	103_A	0.770	0.53
77_C	108_C	0.760	0.52
118_G	126_R	0.752	0.51
41_Y	53_Y	0.752	0.51
7_L	23_E	0.751	0.51
11_C	96_C	0.744	0.50
59_G	62_N	0.742	0.50
14_T	48_P	0.739	0.50
91_C	96_C	0.739	0.50
28_E	34_L	0.738	0.50
67_N	121_G	0.732	0.49
2_E	25_R	0.720	0.48
10_K	15_K	0.719	0.48
87_A	95_H	0.716	0.48
18_Y	22_Y	0.713	0.48
103_A	114_Y	0.713	0.48
77_C	96_C	0.712	0.47
60_S	94_I	0.710	0.47
80_C	105_C	0.708	0.47
26_L	29_S	0.707	0.47
8_L	54_F	0.698	0.46
22_Y	71_L	0.697	0.46
62_N	65_K	0.696	0.46
82_N	98_G	0.694	0.46
31_F	34_L	0.692	0.46
113_T	119_E	0.689	0.45
16_K	23_E	0.688	0.45
53_Y	57_S	0.684	0.45
26_L	33_D	0.683	0.45
41_Y	45_G	0.679	0.44
64_L	128_R	0.672	0.44
53_Y	56_L	0.671	0.44
44_V	49_V	0.671	0.44
82_N	106_P	0.670	0.43
54_F	59_G	0.667	0.43
58_D	66_I	0.664	0.43
107_W	114_Y	0.661	0.43
88_V	94_I	0.658	0.42
27_Q	32_G	0.658	0.42
100_E	124_V	0.655	0.42
10_K	24_K	0.651	0.42
80_C	108_C	0.649	0.41
44_V	66_I	0.647	0.41
118_G	123_D	0.639	0.41
42_R	72_I	0.637	0.40
117_G	124_V	0.637	0.40
4_F	44_V	0.628	0.40
28_E	32_G	0.625	0.39
44_V	83_Q	0.623	0.39
80_C	96_C	0.619	0.39
19_L	23_E	0.617	0.39
39_R	70_E	0.611	0.38
60_S	63_N	0.611	0.38
74_A	86_F	0.610	0.38
86_F	89_C	0.609	0.38
99_G	102_E	0.604	0.37
40_D	72_I	0.602	0.37
90_S	104_T	0.601	0.37
41_Y	68_T	0.598	0.37
19_L	50_D	0.597	0.37
22_Y	54_F	0.596	0.37
20_I	88_V	0.592	0.36
75_P	86_F	0.585	0.36
96_C	105_C	0.585	0.36
10_K	93_K	0.584	0.36
27_Q	37_N	0.582	0.35
41_Y	47_F	0.572	0.35
22_Y	81_G	0.567	0.34
6_V	9_G	0.565	0.34
12_Q	95_H	0.563	0.34
73_G	85_G	0.562	0.34
41_Y	71_L	0.559	0.33
102_E	112_G	0.558	0.33
68_T	71_L	0.549	0.33
107_W	127_G	0.545	0.32
100_E	112_G	0.541	0.32
3_N	44_V	0.535	0.31
58_D	128_R	0.534	0.31
96_C	108_C	0.532	0.31
83_Q	98_G	0.530	0.31
22_Y	45_G	0.529	0.31
13_K	39_R	0.528	0.31
102_E	118_G	0.524	0.31
2_E	70_E	0.524	0.31
62_N	67_N	0.520	0.30
32_G	127_G	0.519	0.30
39_R	49_V	0.518	0.30
83_Q	111_T	0.516	0.30
109_G	125_N	0.513	0.30
112_G	121_G	0.507	0.29
84_F	90_S	0.505	0.29
29_S	37_N	0.503	0.29
25_R	28_E	0.502	0.29
51_E	93_K	0.502	0.29
65_K	101_G	0.501	0.29
51_E	54_F	0.500	0.29

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2xzlA	1	0.3566	72.7	0.9	Contact Map
2ct2A	1	0.5426	71.1	0.901	Contact Map
2wjyA	1	0.3953	64.3	0.905	Contact Map
4txaA	1	0.4496	64.2	0.905	Contact Map
2ectA	1	0.5349	60.1	0.908	Contact Map
2djbA	1	0.5039	60	0.908	Contact Map
2aklA	1	0.3798	57.3	0.909	Contact Map
2ea6A	1	0.4341	56.8	0.91	Contact Map
1gh9A	1	0.3643	52.3	0.912	Contact Map
2ecnA	1	0.5039	49.6	0.913	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.