Imm70 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Imm70 - Immunity protein 70

PFAM:	PF15601	Sequences: FKVGSIWYEVGSYDFFHSFFSTIAYRLEPGGWGSRFPTLMNSLYDGELSPEEAPAALRELEEIREELKKLPPSKVVWDIEDLSKQPPWGDNISKDITSLSNYFVTSDGEDLFERLIELLELAIERGLPILI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	131 (126)
Sequences:	628 (550)
Seq/√Len:	49.0
META:	0.861

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
36_F	62_E	3.394	1.00
42_S	52_E	3.215	1.00
35_R	66_E	2.881	1.00
39_L	63_I	2.709	1.00
57_L	120_E	2.668	1.00
36_F	66_E	2.566	1.00
62_E	66_E	2.560	1.00
98_S	101_N	2.448	1.00
24_A	40_M	2.364	1.00
27_L	36_F	2.312	1.00
97_T	101_N	2.215	1.00
81_D	84_K	2.154	1.00
53_A	122_A	2.126	1.00
16_F	20_F	2.124	1.00
57_L	116_I	1.894	0.99
26_R	74_K	1.871	0.99
29_P	34_S	1.865	0.99
101_N	110_D	1.846	0.99
48_L	56_A	1.839	0.99
28_E	33_G	1.837	0.99
17_H	21_S	1.835	0.99
31_G	34_S	1.792	0.99
57_L	123_I	1.707	0.98
47_E	128_P	1.663	0.98
92_I	96_I	1.630	0.98
61_E	116_I	1.608	0.98
23_I	112_F	1.595	0.97
25_Y	76_V	1.584	0.97
32_W	40_M	1.566	0.97
105_T	114_R	1.530	0.97
25_Y	82_L	1.522	0.97
68_K	100_S	1.518	0.97
24_A	31_G	1.485	0.96
64_R	116_I	1.466	0.96
64_R	113_E	1.437	0.95
54_P	123_I	1.433	0.95
38_T	55_A	1.429	0.95
111_L	115_L	1.420	0.95
6_I	9_E	1.414	0.95
27_L	66_E	1.390	0.94
121_L	125_R	1.290	0.92
5_S	9_E	1.287	0.92
67_L	99_L	1.279	0.92
19_F	99_L	1.269	0.91
10_V	111_L	1.255	0.91
116_I	123_I	1.235	0.90
10_V	16_F	1.222	0.90
88_W	96_I	1.211	0.89
119_L	129_I	1.195	0.88
67_L	70_L	1.173	0.88
21_S	32_W	1.135	0.86
68_K	98_S	1.100	0.84
8_Y	107_D	1.097	0.84
123_I	126_G	1.091	0.83
14_D	17_H	1.072	0.82
65_E	68_K	1.072	0.82
17_H	78_D	1.063	0.82
53_A	104_V	1.062	0.82
24_A	32_W	1.058	0.81
17_H	79_I	1.056	0.81
17_H	32_W	1.035	0.80
17_H	39_L	1.034	0.80
22_T	26_R	1.012	0.78
109_E	117_E	0.996	0.77
58_R	94_K	0.986	0.77
91_N	96_I	0.985	0.77
22_T	67_L	0.976	0.76
26_R	66_E	0.974	0.76
17_H	24_A	0.970	0.75
53_A	123_I	0.970	0.75
97_T	110_D	0.957	0.74
37_P	59_E	0.956	0.74
5_S	8_Y	0.945	0.74
5_S	107_D	0.944	0.73
88_W	93_S	0.938	0.73
89_G	92_I	0.923	0.72
124_E	127_L	0.900	0.70
115_L	123_I	0.900	0.70
28_E	35_R	0.875	0.68
53_A	119_L	0.867	0.67
15_F	19_F	0.855	0.66
58_R	61_E	0.852	0.66
127_L	130_L	0.842	0.65
38_T	59_E	0.839	0.64
88_W	92_I	0.836	0.64
19_F	92_I	0.834	0.64
45_D	109_E	0.832	0.64
75_V	86_P	0.831	0.64
24_A	29_P	0.824	0.63
85_Q	90_D	0.815	0.62
50_P	126_G	0.813	0.62
50_P	122_A	0.807	0.61
45_D	79_I	0.800	0.61
78_D	84_K	0.794	0.60
73_S	90_D	0.794	0.60
93_S	96_I	0.784	0.59
22_T	99_L	0.783	0.59
64_R	110_D	0.769	0.58
13_Y	43_L	0.767	0.57
28_E	34_S	0.760	0.57
53_A	57_L	0.756	0.56
38_T	52_E	0.742	0.55
124_E	128_P	0.740	0.55
75_V	102_Y	0.730	0.54
26_R	76_V	0.703	0.51
100_S	110_D	0.703	0.51
16_F	82_L	0.693	0.50
92_I	106_S	0.690	0.50
99_L	103_F	0.689	0.50
17_H	44_Y	0.668	0.47
24_A	39_L	0.665	0.47
117_E	120_E	0.657	0.46
50_P	128_P	0.657	0.46
120_E	126_G	0.654	0.46
25_Y	79_I	0.651	0.46
22_T	76_V	0.650	0.46
56_A	119_L	0.646	0.45
14_D	84_K	0.643	0.45
99_L	119_L	0.642	0.45
32_W	43_L	0.638	0.44
40_M	44_Y	0.634	0.44
111_L	117_E	0.634	0.44
20_F	44_Y	0.630	0.44
51_E	123_I	0.628	0.43
59_E	103_F	0.622	0.43
8_Y	118_L	0.622	0.43
18_S	78_D	0.621	0.43
7_W	80_E	0.615	0.42
77_W	86_P	0.615	0.42
28_E	40_M	0.614	0.42
96_I	102_Y	0.613	0.42
104_V	110_D	0.612	0.42
16_F	111_L	0.611	0.42
44_Y	102_Y	0.602	0.41
78_D	97_T	0.599	0.40
89_G	96_I	0.598	0.40
116_I	120_E	0.595	0.40
28_E	32_W	0.592	0.40
20_F	48_L	0.585	0.39
49_S	128_P	0.585	0.39
35_R	62_E	0.583	0.39
116_I	119_L	0.578	0.38
23_I	115_L	0.577	0.38
55_A	61_E	0.576	0.38
57_L	119_L	0.573	0.38
81_D	85_Q	0.571	0.38
120_E	127_L	0.571	0.38
51_E	61_E	0.568	0.37
18_S	103_F	0.564	0.37
15_F	108_G	0.564	0.37
28_E	37_P	0.564	0.37
20_F	43_L	0.563	0.37
121_L	124_E	0.563	0.37
119_L	123_I	0.559	0.37
21_S	26_R	0.559	0.37
18_S	76_V	0.556	0.36
90_D	94_K	0.555	0.36
75_V	112_F	0.554	0.36
77_W	89_G	0.553	0.36
21_S	77_W	0.553	0.36
16_F	115_L	0.551	0.36
69_K	74_K	0.550	0.36
5_S	13_Y	0.550	0.36
42_S	48_L	0.549	0.36
90_D	101_N	0.547	0.36
6_I	107_D	0.544	0.35
62_E	98_S	0.542	0.35
56_A	59_E	0.539	0.35
16_F	129_I	0.537	0.35
35_R	51_E	0.537	0.35
47_E	98_S	0.537	0.35
52_E	129_I	0.535	0.34
54_P	67_L	0.533	0.34
53_A	128_P	0.531	0.34
46_G	115_L	0.528	0.34
77_W	87_P	0.528	0.34
118_L	129_I	0.527	0.34
24_A	79_I	0.525	0.34
71_P	111_L	0.524	0.33
69_K	91_N	0.524	0.33
52_E	126_G	0.518	0.33
96_I	110_D	0.517	0.33
18_S	21_S	0.516	0.33
26_R	70_L	0.515	0.33
15_F	93_S	0.510	0.32
34_S	111_L	0.509	0.32
64_R	100_S	0.508	0.32
89_G	104_V	0.508	0.32
47_E	130_L	0.500	0.31

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4fnqA	4	0.9008	28	0.927	Contact Map
3mi6A	4	0.8931	25.4	0.928	Contact Map
1nbaA	4	0.5954	22.8	0.93	Contact Map
3u65B	1	0.9237	22.7	0.93	Contact Map
2yfoA	4	0.9008	21.2	0.931	Contact Map
4pytA	1	0.4733	18.9	0.932	Contact Map
2v5cA	1	0.8321	14.2	0.936	Contact Map
2v5dA	1	0.7634	14.1	0.936	Contact Map
1nowA	2	0.9237	13.4	0.937	Contact Map
3hu5A	3	0.3282	11.5	0.939	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.