Imm63 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Imm63 - Immunity protein 63

PFAM:	PF15599	Sequences: NGGYHYVVVERGQELERRTTTDLDELLYWIFEDVTFSMASDYELKHRIEGQDFFRRILFAKQLELLGKLNPEWAERLEAEIDE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	83 (77)
Sequences:	967 (846)
Seq/√Len:	96.4
META:	0.874

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
18_R	29_W	3.276	1.00
40_S	58_L	3.003	1.00
43_E	47_R	2.841	1.00
14_E	17_R	2.758	1.00
35_T	62_Q	2.747	1.00
61_K	64_E	2.595	1.00
51_Q	57_I	2.295	1.00
36_F	58_L	2.138	1.00
20_T	29_W	2.103	1.00
66_L	77_L	2.056	1.00
36_F	40_S	2.015	1.00
67_G	74_A	1.767	1.00
63_L	74_A	1.716	1.00
35_T	66_L	1.662	1.00
7_V	14_E	1.502	1.00
55_R	59_F	1.454	1.00
5_H	19_T	1.439	1.00
69_L	73_W	1.378	0.99
3_G	19_T	1.351	0.99
20_T	26_L	1.335	0.99
42_Y	61_K	1.327	0.99
7_V	17_R	1.311	0.99
6_Y	33_D	1.307	0.99
31_F	69_L	1.276	0.99
24_D	70_N	1.264	0.99
48_I	51_Q	1.248	0.99
53_F	58_L	1.234	0.99
24_D	27_L	1.223	0.99
74_A	78_E	1.220	0.99
50_G	53_F	1.177	0.98
31_F	62_Q	1.175	0.98
49_E	52_D	1.156	0.98
35_T	65_L	1.142	0.98
9_V	15_L	1.129	0.98
42_Y	57_I	1.098	0.97
49_E	53_F	1.069	0.97
31_F	35_T	1.059	0.96
70_N	73_W	1.053	0.96
75_E	79_A	1.025	0.96
39_A	58_L	1.019	0.95
32_E	77_L	1.016	0.95
20_T	23_L	1.010	0.95
36_F	62_Q	0.987	0.95
28_Y	80_E	0.980	0.94
42_Y	46_H	0.971	0.94
43_E	46_H	0.949	0.93
25_E	76_R	0.932	0.93
63_L	67_G	0.923	0.92
41_D	45_K	0.891	0.91
20_T	25_E	0.883	0.91
42_Y	47_R	0.865	0.90
8_V	15_L	0.843	0.88
9_V	13_Q	0.841	0.88
24_D	73_W	0.777	0.84
57_I	60_A	0.761	0.83
75_E	78_E	0.760	0.83
8_V	16_E	0.752	0.82
10_E	15_L	0.752	0.82
5_H	17_R	0.746	0.82
6_Y	28_Y	0.746	0.82
71_P	74_A	0.744	0.81
22_D	25_E	0.740	0.81
67_G	78_E	0.736	0.81
43_E	57_I	0.733	0.80
44_L	47_R	0.728	0.80
9_V	30_I	0.723	0.80
62_Q	65_L	0.721	0.79
9_V	14_E	0.707	0.78
48_I	57_I	0.700	0.77
43_E	53_F	0.696	0.77
35_T	77_L	0.694	0.77
63_L	77_L	0.689	0.76
28_Y	76_R	0.679	0.75
37_S	41_D	0.655	0.72
32_E	62_Q	0.651	0.72
21_T	45_K	0.635	0.70
37_S	45_K	0.631	0.70
27_L	73_W	0.631	0.70
43_E	52_D	0.630	0.70
56_R	59_F	0.629	0.69
36_F	39_A	0.616	0.68
3_G	21_T	0.612	0.67
9_V	17_R	0.611	0.67
77_L	80_E	0.611	0.67
23_L	73_W	0.603	0.66
62_Q	66_L	0.601	0.66
63_L	78_E	0.600	0.66
24_D	76_R	0.594	0.65
31_F	77_L	0.581	0.63
66_L	74_A	0.579	0.63
5_H	12_G	0.577	0.63
68_K	71_P	0.575	0.63
72_E	78_E	0.567	0.61
6_Y	34_V	0.562	0.61
76_R	80_E	0.561	0.61
45_K	61_K	0.559	0.60
35_T	39_A	0.553	0.60
31_F	36_F	0.549	0.59
12_G	26_L	0.545	0.58
46_H	61_K	0.545	0.58
39_A	65_L	0.543	0.58
4_Y	73_W	0.537	0.57
35_T	63_L	0.535	0.57
48_I	79_A	0.535	0.57
47_R	55_R	0.531	0.57
9_V	12_G	0.531	0.57
47_R	52_D	0.530	0.56
25_E	50_G	0.521	0.55
7_V	65_L	0.519	0.55
21_T	41_D	0.512	0.54
34_V	38_M	0.510	0.54
10_E	43_E	0.507	0.53
4_Y	28_Y	0.503	0.53
51_Q	71_P	0.502	0.52
4_Y	22_D	0.500	0.52
30_I	33_D	0.500	0.52

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2abyA	1	0.8554	5.1	0.904	Contact Map
4q6kA	4	0.3373	3.9	0.91	Contact Map
4g55A	1	0.5542	3.5	0.912	Contact Map
1nycA	1	0.7229	2.9	0.915	Contact Map
1tviA	1	0.9277	2.8	0.916	Contact Map
4jpsB	1	0.8434	2.4	0.919	Contact Map
3hlzA	1	0.9036	2.3	0.92	Contact Map
4by6C	1	0.9398	2.2	0.921	Contact Map
2b4wA	1	0.4578	2.1	0.921	Contact Map
1w2yA	2	0.4217	1.9	0.923	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0042 seconds.