Imm51 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Imm51 - Immunity protein 51

PFAM:	PF15595	Sequences: FFWVEHEDGSGSVCLNLGDYKPEAFGERFEEEGFEGNGYDWESLARVFLEEKAPELLERIEFDPEAGMFCAYSEDREALEKFAELFKAACEDEELLRDLFSRAED	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	105 (99)
Sequences:	820 (653)
Seq/√Len:	65.6
META:	0.785

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
42_E	64_P	5.083	1.00
55_E	81_K	3.577	1.00
36_G	40_D	3.060	1.00
59_R	75_D	2.980	1.00
39_Y	64_P	2.624	1.00
45_A	82_F	2.353	1.00
98_D	102_R	2.155	1.00
37_N	67_G	2.148	1.00
39_Y	65_E	2.139	1.00
62_F	69_F	2.130	1.00
76_R	80_E	1.709	0.99
46_R	50_E	1.697	0.99
89_A	95_L	1.674	0.99
45_A	86_F	1.550	0.99
35_E	40_D	1.546	0.99
87_K	91_E	1.528	0.99
38_G	65_E	1.502	0.99
60_I	71_A	1.500	0.99
42_E	46_R	1.476	0.98
82_F	86_F	1.454	0.98
98_D	101_S	1.430	0.98
25_F	28_R	1.386	0.98
34_F	40_D	1.383	0.98
89_A	96_L	1.366	0.97
49_L	62_F	1.326	0.97
96_L	100_F	1.296	0.96
44_L	96_L	1.295	0.96
13_V	83_A	1.292	0.96
6_H	10_S	1.290	0.96
83_A	87_K	1.282	0.96
53_A	85_L	1.262	0.96
39_Y	63_D	1.262	0.96
5_E	11_G	1.261	0.96
51_E	103_A	1.248	0.96
48_F	85_L	1.206	0.95
95_L	98_D	1.206	0.95
25_F	29_F	1.205	0.95
99_L	103_A	1.194	0.94
21_K	93_E	1.174	0.94
22_P	26_G	1.149	0.93
50_E	57_L	1.135	0.93
14_C	17_L	1.132	0.93
66_A	70_C	1.125	0.92
17_L	67_G	1.086	0.91
56_L	60_I	1.073	0.90
65_E	68_M	1.057	0.90
77_E	80_E	1.052	0.90
24_A	28_R	1.046	0.89
93_E	97_R	1.032	0.89
39_Y	66_A	1.024	0.88
34_F	43_S	1.017	0.88
86_F	90_C	0.991	0.87
87_K	92_D	0.978	0.86
75_D	78_A	0.953	0.84
47_V	51_E	0.952	0.84
87_K	90_C	0.914	0.82
37_N	65_E	0.892	0.80
20_Y	23_E	0.889	0.80
6_H	11_G	0.869	0.78
48_F	82_F	0.862	0.78
52_K	56_L	0.855	0.77
7_E	10_S	0.843	0.76
47_V	100_F	0.842	0.76
59_R	78_A	0.840	0.76
37_N	66_A	0.838	0.76
58_E	61_E	0.830	0.75
53_A	81_K	0.822	0.74
6_H	12_S	0.816	0.74
73_S	78_A	0.811	0.73
38_G	66_A	0.807	0.73
22_P	29_F	0.806	0.73
49_L	57_L	0.802	0.73
9_G	92_D	0.801	0.73
88_A	95_L	0.789	0.71
9_G	61_E	0.787	0.71
45_A	99_L	0.785	0.71
83_A	96_L	0.785	0.71
51_E	102_R	0.782	0.71
29_F	40_D	0.771	0.70
48_F	86_F	0.767	0.69
44_L	100_F	0.761	0.69
10_S	14_C	0.755	0.68
45_A	69_F	0.752	0.68
21_K	49_L	0.752	0.68
26_G	29_F	0.748	0.67
38_G	63_D	0.743	0.67
40_D	43_S	0.742	0.67
9_G	14_C	0.740	0.66
90_C	96_L	0.736	0.66
35_E	67_G	0.724	0.65
40_D	79_L	0.721	0.64
63_D	66_A	0.716	0.64
56_L	78_A	0.710	0.63
29_F	96_L	0.708	0.63
57_L	60_I	0.708	0.63
62_F	87_K	0.705	0.63
13_V	16_N	0.703	0.62
29_F	36_G	0.702	0.62
9_G	77_E	0.701	0.62
11_G	17_L	0.699	0.62
73_S	79_L	0.685	0.60
59_R	81_K	0.668	0.59
22_P	67_G	0.667	0.58
29_F	44_L	0.662	0.58
45_A	79_L	0.657	0.57
7_E	19_D	0.657	0.57
39_Y	68_M	0.655	0.57
6_H	9_G	0.652	0.57
26_G	30_E	0.648	0.56
28_R	31_E	0.634	0.55
56_L	87_K	0.634	0.55
15_L	36_G	0.627	0.54
98_D	104_E	0.620	0.53
44_L	89_A	0.617	0.53
76_R	88_A	0.608	0.52
61_E	67_G	0.607	0.51
60_I	72_Y	0.606	0.51
38_G	41_W	0.597	0.50
34_F	44_L	0.597	0.50
56_L	81_K	0.582	0.49
29_F	100_F	0.573	0.47
25_F	97_R	0.572	0.47
63_D	68_M	0.571	0.47
95_L	100_F	0.570	0.47
32_E	62_F	0.565	0.47
44_L	99_L	0.564	0.46
88_A	98_D	0.564	0.46
81_K	85_L	0.559	0.46
10_S	60_I	0.559	0.46
50_E	55_E	0.554	0.45
42_E	62_F	0.552	0.45
21_K	91_E	0.550	0.45
17_L	37_N	0.542	0.44
25_F	36_G	0.542	0.44
15_L	79_L	0.537	0.43
47_V	99_L	0.537	0.43
53_A	83_A	0.536	0.43
95_L	101_S	0.533	0.43
39_Y	42_E	0.531	0.43
47_V	52_K	0.530	0.42
94_E	101_S	0.525	0.42
47_V	102_R	0.521	0.41
13_V	17_L	0.520	0.41
32_E	100_F	0.512	0.40
5_E	76_R	0.511	0.40
73_S	83_A	0.507	0.40
86_F	100_F	0.503	0.39
12_S	16_N	0.500	0.39

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1uwkA	2	0.8857	23.6	0.885	Contact Map
1x87A	2	0.8857	23.2	0.885	Contact Map
2fknA	2	0.8857	23.1	0.885	Contact Map
1ik9A	2	0.8857	10	0.903	Contact Map
1muwA	4	0.9619	7.6	0.908	Contact Map
1yprA	1	0.6095	6.5	0.911	Contact Map
1z56A	2	0.1048	6.5	0.911	Contact Map
1y2tA	4	0.8952	6.5	0.911	Contact Map
1wv8A	2	0.4952	6.1	0.912	Contact Map
2ofcA	4	0.8952	6	0.912	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.