Imm42 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Imm42 - Immunity protein 42

PFAM:	PF15593	Sequences: MIIGDPSKFAIESEIVEAWEDSSWALGFFVIWIGGRRYGDREPDATLLACSFDLVDRRIALRGKHTDPFLFELDAEEIFDALYDAFYFPGDDFDELDEDYESNYRFDISGDEAFDDGSYVFLVDNGDRVRLIWSDDDDPTISEVWLPAGEFYSVLEELKKW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	161 (157)
Sequences:	567 (523)
Seq/√Len:	41.8
META:	0.762

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
130_R	143_E	5.154	1.00
74_D	77_E	3.187	1.00
6_P	10_A	3.130	1.00
106_F	109_S	3.038	1.00
12_E	32_W	3.025	1.00
75_A	143_E	2.407	1.00
150_E	154_V	2.404	1.00
1_M	4_G	2.359	1.00
8_K	150_E	2.254	1.00
88_F	93_F	2.253	1.00
37_R	41_R	2.189	1.00
6_P	19_W	2.132	0.99
29_F	33_I	2.112	0.99
124_D	129_V	2.068	0.99
146_L	151_F	1.983	0.99
12_E	39_G	1.982	0.99
88_F	95_E	1.964	0.99
129_V	149_G	1.950	0.99
133_W	136_D	1.940	0.99
33_I	55_V	1.920	0.99
147_P	150_E	1.851	0.98
112_E	115_D	1.842	0.98
103_N	106_F	1.798	0.98
16_V	19_W	1.749	0.98
87_Y	93_F	1.744	0.98
32_W	37_R	1.732	0.97
4_G	10_A	1.730	0.97
153_S	157_E	1.700	0.97
39_G	114_F	1.654	0.97
49_A	53_D	1.643	0.97
24_W	48_L	1.641	0.97
146_L	155_L	1.637	0.96
134_S	138_D	1.614	0.96
125_N	145_W	1.557	0.95
86_F	93_F	1.510	0.94
152_Y	155_L	1.482	0.94
36_R	142_S	1.461	0.93
9_F	131_L	1.450	0.93
11_I	153_S	1.439	0.93
27_G	46_T	1.435	0.93
135_D	139_P	1.433	0.93
40_D	45_A	1.431	0.93
33_I	123_V	1.423	0.92
61_L	101_E	1.421	0.92
100_Y	104_Y	1.403	0.92
32_W	39_G	1.403	0.92
31_I	55_V	1.398	0.92
5_D	35_G	1.365	0.91
67_D	70_L	1.347	0.90
136_D	140_T	1.319	0.89
45_A	112_E	1.308	0.89
87_Y	90_G	1.290	0.88
71_F	125_N	1.283	0.88
19_W	26_L	1.278	0.88
141_I	145_W	1.264	0.87
59_I	63_G	1.260	0.87
12_E	114_F	1.257	0.87
39_G	124_D	1.231	0.86
1_M	5_D	1.214	0.85
36_R	156_E	1.202	0.84
79_F	82_L	1.201	0.84
83_Y	119_Y	1.196	0.84
11_I	72_E	1.182	0.83
48_L	152_Y	1.178	0.83
5_D	8_K	1.168	0.82
45_A	119_Y	1.166	0.82
136_D	139_P	1.165	0.82
90_G	93_F	1.133	0.80
78_I	130_R	1.131	0.80
21_D	24_W	1.131	0.80
23_S	47_L	1.126	0.80
89_P	96_L	1.117	0.80
100_Y	103_N	1.113	0.79
82_L	119_Y	1.111	0.79
11_I	155_L	1.107	0.79
137_D	140_T	1.095	0.78
29_F	50_C	1.087	0.78
87_Y	91_D	1.084	0.77
149_G	154_V	1.081	0.77
133_W	139_P	1.051	0.75
15_I	25_A	1.046	0.75
34_G	144_V	1.013	0.72
76_E	80_D	1.011	0.72
17_E	94_D	0.960	0.68
28_F	39_G	0.955	0.68
128_R	145_W	0.935	0.66
130_R	145_W	0.925	0.65
68_P	146_L	0.916	0.65
89_P	92_D	0.914	0.64
31_I	129_V	0.902	0.63
4_G	9_F	0.880	0.61
55_V	155_L	0.875	0.61
32_W	40_D	0.872	0.61
146_L	150_E	0.866	0.60
105_R	108_I	0.866	0.60
150_E	153_S	0.861	0.60
149_G	153_S	0.861	0.60
128_R	147_P	0.858	0.60
82_L	105_R	0.845	0.58
86_F	90_G	0.844	0.58
107_D	110_G	0.843	0.58
8_K	77_E	0.841	0.58
10_A	132_I	0.837	0.58
126_G	141_I	0.832	0.57
38_Y	46_T	0.828	0.57
87_Y	97_D	0.826	0.57
134_S	139_P	0.822	0.56
26_L	121_F	0.811	0.55
30_V	37_R	0.809	0.55
69_F	81_A	0.806	0.55
5_D	141_I	0.806	0.55
90_G	95_E	0.803	0.54
34_G	38_Y	0.799	0.54
73_L	105_R	0.796	0.54
80_D	135_D	0.795	0.54
10_A	127_D	0.794	0.54
152_Y	156_E	0.793	0.54
2_I	150_E	0.793	0.54
24_W	53_D	0.789	0.53
93_F	97_D	0.781	0.52
129_V	152_Y	0.780	0.52
2_I	5_D	0.776	0.52
129_V	146_L	0.774	0.52
102_S	109_S	0.773	0.52
111_D	114_F	0.769	0.51
79_F	141_I	0.749	0.49
78_I	132_I	0.749	0.49
110_G	115_D	0.741	0.49
2_I	56_D	0.738	0.48
129_V	132_I	0.732	0.48
42_E	140_T	0.731	0.48
144_V	153_S	0.723	0.47
102_S	108_I	0.720	0.47
1_M	100_Y	0.720	0.47
26_L	114_F	0.715	0.46
30_V	112_E	0.715	0.46
7_S	16_V	0.713	0.46
69_F	77_E	0.705	0.45
28_F	50_C	0.703	0.45
111_D	120_V	0.697	0.45
77_E	148_A	0.691	0.44
42_E	147_P	0.687	0.44
87_Y	95_E	0.687	0.44
110_G	113_A	0.685	0.43
33_I	38_Y	0.681	0.43
45_A	113_A	0.676	0.43
99_D	102_S	0.673	0.42
31_I	108_I	0.672	0.42
94_D	154_V	0.667	0.42
153_S	156_E	0.664	0.42
9_F	154_V	0.664	0.42
3_I	13_S	0.663	0.41
89_P	95_E	0.661	0.41
1_M	14_E	0.656	0.41
33_I	135_D	0.656	0.41
151_F	154_V	0.655	0.41
14_E	28_F	0.643	0.40
27_G	106_F	0.643	0.40
101_E	104_Y	0.640	0.39
87_Y	96_L	0.638	0.39
92_D	95_E	0.638	0.39
90_G	98_E	0.637	0.39
133_W	137_D	0.633	0.39
122_L	129_V	0.633	0.39
61_L	67_D	0.632	0.39
61_L	65_H	0.626	0.38
11_I	126_G	0.626	0.38
86_F	89_P	0.625	0.38
29_F	110_G	0.625	0.38
43_P	154_V	0.620	0.38
8_K	47_L	0.618	0.37
106_F	110_G	0.617	0.37
45_A	111_D	0.615	0.37
25_A	29_F	0.614	0.37
1_M	37_R	0.612	0.37
34_G	142_S	0.610	0.37
68_P	74_D	0.610	0.37
76_E	98_E	0.585	0.35
117_G	127_D	0.585	0.35
114_F	151_F	0.584	0.34
2_I	6_P	0.578	0.34
56_D	93_F	0.578	0.34
38_Y	79_F	0.576	0.34
82_L	121_F	0.574	0.34
5_D	19_W	0.571	0.33
5_D	20_E	0.569	0.33
131_L	155_L	0.568	0.33
31_I	52_F	0.568	0.33
76_E	99_D	0.567	0.33
24_W	46_T	0.565	0.33
126_G	146_L	0.561	0.33
25_A	48_L	0.559	0.32
17_E	23_S	0.557	0.32
61_L	64_K	0.556	0.32
26_L	39_G	0.556	0.32
30_V	39_G	0.556	0.32
54_L	155_L	0.556	0.32
50_C	110_G	0.550	0.32
58_R	67_D	0.550	0.32
9_F	31_I	0.546	0.31
91_D	95_E	0.542	0.31
12_E	30_V	0.542	0.31
96_L	104_Y	0.539	0.31
70_L	80_D	0.538	0.31
15_I	29_F	0.538	0.31
92_D	97_D	0.536	0.31
90_G	137_D	0.534	0.30
32_W	122_L	0.534	0.30
48_L	52_F	0.533	0.30
4_G	35_G	0.533	0.30
64_K	102_S	0.532	0.30
127_D	131_L	0.532	0.30
96_L	99_D	0.531	0.30
45_A	132_I	0.530	0.30
76_E	83_Y	0.522	0.29
139_P	156_E	0.518	0.29
108_I	129_V	0.517	0.29
15_I	18_A	0.515	0.29
73_L	78_I	0.512	0.29
6_P	16_V	0.512	0.29
21_D	38_Y	0.512	0.29
3_I	18_A	0.512	0.29
28_F	54_L	0.511	0.29
79_F	139_P	0.510	0.29
88_F	97_D	0.510	0.29
51_S	55_V	0.509	0.28
8_K	36_R	0.507	0.28
23_S	49_A	0.507	0.28
7_S	34_G	0.506	0.28
22_S	45_A	0.505	0.28
16_V	47_L	0.505	0.28
6_P	32_W	0.502	0.28
7_S	12_E	0.501	0.28
73_L	77_E	0.501	0.28
3_I	60_A	0.501	0.28
45_A	72_E	0.500	0.28

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ayzA	1	0.5963	2.8	0.942	Contact Map
3oakC	1	0.1056	2	0.946	Contact Map
2b86A	1	0.236	1.9	0.947	Contact Map
4ak2A	1	0.354	1.3	0.951	Contact Map
1nm7A	1	0.2112	1.3	0.951	Contact Map
3bpqA	2	0.118	1.3	0.952	Contact Map
4khbA	1	0.5031	1.2	0.952	Contact Map
1lucB	1	0.3106	1.2	0.953	Contact Map
2m1mA	1	0.2236	1.2	0.953	Contact Map
2q0vA	1	0.4534	1.2	0.953	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.