Imm27 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Imm27 - Immunity protein 27

PFAM:	PF15590	Sequences: DEVCERIEWLISNYLEKIATDMSSPDSGGWETLYRDPRDGRYWELTYPQSEMHGGGPPRLRVLSAEEARAKYGI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	74 (66)
Sequences:	798 (671)
Seq/√Len:	82.5
META:	0.969

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
4_C	58_P	3.320	1.00
49_Q	52_M	3.045	1.00
14_Y	38_R	2.828	1.00
16_E	35_R	2.801	1.00
44_E	72_Y	2.551	1.00
31_E	71_K	2.503	1.00
17_K	32_T	2.465	1.00
9_W	13_N	2.223	1.00
31_E	46_T	2.047	1.00
30_W	50_S	1.993	1.00
41_R	62_V	1.883	1.00
17_K	20_T	1.820	1.00
36_D	39_D	1.675	1.00
34_Y	45_L	1.642	1.00
27_S	31_E	1.488	0.99
30_W	47_Y	1.407	0.99
11_I	14_Y	1.401	0.99
64_S	67_E	1.367	0.99
9_W	14_Y	1.285	0.98
26_D	29_G	1.249	0.98
36_D	41_R	1.202	0.97
65_A	69_R	1.186	0.97
30_W	54_G	1.143	0.96
52_M	57_P	1.121	0.96
4_C	59_R	1.107	0.96
33_L	44_E	1.100	0.95
6_R	10_L	1.099	0.95
35_R	42_Y	1.087	0.95
44_E	71_K	1.083	0.95
15_L	41_R	1.077	0.95
47_Y	58_P	1.055	0.94
11_I	34_Y	1.049	0.94
18_I	42_Y	1.004	0.93
48_P	59_R	1.000	0.92
30_W	53_H	0.936	0.90
32_T	45_L	0.916	0.89
63_L	71_K	0.875	0.86
63_L	67_E	0.868	0.86
33_L	68_A	0.863	0.85
4_C	13_N	0.858	0.85
6_R	41_R	0.849	0.85
26_D	31_E	0.801	0.81
29_G	60_L	0.783	0.79
6_R	37_P	0.772	0.78
49_Q	57_P	0.767	0.78
12_S	61_R	0.762	0.78
14_Y	37_P	0.758	0.77
4_C	8_E	0.754	0.77
5_E	61_R	0.744	0.76
8_E	12_S	0.742	0.76
20_T	32_T	0.737	0.75
50_S	53_H	0.736	0.75
46_T	61_R	0.735	0.75
49_Q	62_V	0.732	0.75
8_E	58_P	0.722	0.74
46_T	59_R	0.721	0.74
9_W	32_T	0.721	0.74
17_K	47_Y	0.705	0.72
6_R	9_W	0.700	0.71
9_W	38_R	0.697	0.71
35_R	65_A	0.685	0.70
33_L	39_D	0.674	0.69
70_A	73_G	0.656	0.66
30_W	48_P	0.632	0.64
13_N	16_E	0.628	0.63
44_E	61_R	0.622	0.62
42_Y	62_V	0.617	0.62
47_Y	50_S	0.613	0.61
66_E	70_A	0.606	0.60
65_A	73_G	0.606	0.60
10_L	39_D	0.605	0.60
10_L	15_L	0.601	0.60
5_E	66_E	0.600	0.60
15_L	36_D	0.600	0.60
20_T	28_G	0.590	0.58
55_G	64_S	0.590	0.58
49_Q	58_P	0.590	0.58
28_G	31_E	0.588	0.58
67_E	70_A	0.584	0.58
16_E	62_V	0.581	0.57
26_D	58_P	0.581	0.57
7_I	54_G	0.577	0.57
30_W	55_G	0.571	0.56
47_Y	53_H	0.566	0.55
6_R	36_D	0.563	0.55
51_E	55_G	0.547	0.53
13_N	59_R	0.540	0.52
5_E	8_E	0.537	0.51
32_T	47_Y	0.533	0.51
35_R	40_G	0.532	0.51
68_A	72_Y	0.527	0.50
33_L	72_Y	0.526	0.50
50_S	54_G	0.525	0.50
11_I	18_I	0.514	0.48
42_Y	65_A	0.513	0.48
50_S	55_G	0.509	0.48
45_L	58_P	0.509	0.48
62_V	65_A	0.502	0.47
18_I	35_R	0.500	0.47

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2kjzA	2	0.6351	35.9	0.891	Contact Map
3sk2A	2	0.6216	28.2	0.897	Contact Map
4nvsA	2	0.9054	27	0.898	Contact Map
3kolA	2	0.6216	24.3	0.9	Contact Map
4g6xA	2	0.6081	21.3	0.903	Contact Map
3ct8A	2	0.6216	21.3	0.903	Contact Map
2vpqA	2	0.9054	19.2	0.905	Contact Map
3omsA	2	0.6081	17.7	0.907	Contact Map
4pavA	9	0.6081	17.3	0.907	Contact Map
1gk8I	3	0.7838	15.3	0.909	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0044 seconds.