Imm10 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Imm10 - Immunity protein 10

PFAM:	PF15588	Sequences: TARAATVEVDEDDDVLVVGFADDEDGPGRYLILQRALEFDEQDVALGMDTYYCEVNDQGASGYGGIESVELSRDRLRVELDPEAAERLGLDGIEVTFDLDDEEYE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	105 (97)
Sequences:	637 (541)
Seq/√Len:	54.9
META:	0.772

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
22_D	28_G	3.321	1.00
22_D	27_P	3.149	1.00
62_G	84_A	3.134	1.00
62_G	65_G	3.013	1.00
20_F	97_F	2.809	1.00
19_G	32_I	2.783	1.00
42_Q	46_L	2.706	1.00
54_E	58_Q	2.426	1.00
42_Q	47_G	2.214	1.00
70_E	77_R	1.985	1.00
30_Y	61_S	1.860	0.99
67_E	79_E	1.851	0.99
29_R	56_N	1.775	0.99
42_Q	48_M	1.724	0.99
67_E	81_D	1.616	0.98
44_V	49_D	1.578	0.98
30_Y	54_E	1.535	0.98
80_L	93_I	1.532	0.98
58_Q	61_S	1.458	0.97
31_L	47_G	1.446	0.97
42_Q	49_D	1.424	0.96
20_F	76_L	1.413	0.96
15_V	37_L	1.395	0.96
41_E	45_A	1.372	0.96
22_D	25_D	1.354	0.95
12_D	93_I	1.311	0.94
4_A	8_E	1.300	0.94
62_G	88_L	1.296	0.94
54_E	62_G	1.278	0.94
35_R	39_F	1.268	0.93
55_V	58_Q	1.266	0.93
54_E	80_L	1.265	0.93
77_R	94_E	1.251	0.93
30_Y	56_N	1.248	0.93
96_T	100_D	1.238	0.92
29_R	57_D	1.200	0.91
71_L	78_V	1.163	0.90
75_R	94_E	1.153	0.90
56_N	60_A	1.140	0.89
81_D	84_A	1.132	0.89
39_F	48_M	1.129	0.89
17_V	66_I	1.124	0.88
23_D	28_G	1.120	0.88
89_G	98_D	1.111	0.88
61_S	76_L	1.107	0.88
36_A	39_F	1.104	0.87
73_R	80_L	1.087	0.87
22_D	26_G	1.065	0.85
69_V	76_L	1.063	0.85
86_E	96_T	1.054	0.85
39_F	92_G	1.047	0.84
11_E	37_L	1.046	0.84
39_F	43_D	0.969	0.80
54_E	61_S	0.968	0.79
19_G	30_Y	0.956	0.79
40_D	50_T	0.949	0.78
44_V	48_M	0.940	0.77
85_A	91_D	0.918	0.76
56_N	61_S	0.916	0.76
49_D	83_E	0.900	0.74
11_E	16_L	0.894	0.74
32_I	69_V	0.856	0.70
34_Q	57_D	0.848	0.70
16_L	37_L	0.846	0.70
40_D	77_R	0.838	0.69
18_V	39_F	0.830	0.68
33_L	69_V	0.829	0.68
56_N	92_G	0.806	0.66
17_V	32_I	0.788	0.64
30_Y	66_I	0.784	0.64
59_G	87_R	0.778	0.63
34_Q	52_Y	0.770	0.62
34_Q	61_S	0.766	0.62
38_E	43_D	0.763	0.62
82_P	93_I	0.758	0.61
65_G	80_L	0.752	0.60
4_A	7_V	0.743	0.59
18_V	92_G	0.735	0.59
47_G	85_A	0.727	0.58
76_L	97_F	0.724	0.58
10_D	13_D	0.722	0.57
73_R	100_D	0.720	0.57
34_Q	43_D	0.716	0.57
72_S	75_R	0.713	0.56
20_F	53_C	0.712	0.56
66_I	69_V	0.710	0.56
40_D	48_M	0.709	0.56
50_T	66_I	0.703	0.55
35_R	51_Y	0.699	0.55
20_F	92_G	0.699	0.55
15_V	23_D	0.697	0.55
72_S	79_E	0.697	0.55
31_L	63_Y	0.691	0.54
41_E	46_L	0.690	0.54
53_C	80_L	0.689	0.54
69_V	78_V	0.675	0.52
5_A	8_E	0.674	0.52
63_Y	78_V	0.659	0.51
53_C	59_G	0.658	0.50
25_D	77_R	0.658	0.50
25_D	28_G	0.651	0.50
33_L	55_V	0.650	0.50
51_Y	65_G	0.637	0.48
31_L	73_R	0.632	0.48
57_D	90_L	0.631	0.48
11_E	70_E	0.630	0.47
39_F	50_T	0.630	0.47
12_D	36_A	0.622	0.47
34_Q	70_E	0.619	0.46
52_Y	61_S	0.611	0.45
26_G	83_E	0.610	0.45
10_D	14_D	0.607	0.45
50_T	64_G	0.603	0.45
59_G	68_S	0.601	0.44
26_G	79_E	0.601	0.44
77_R	91_D	0.598	0.44
54_E	66_I	0.593	0.44
28_G	99_L	0.589	0.43
8_E	12_D	0.586	0.43
39_F	49_D	0.584	0.43
60_A	88_L	0.582	0.42
23_D	95_V	0.576	0.42
46_L	74_D	0.572	0.41
70_E	93_I	0.571	0.41
39_F	69_V	0.567	0.41
82_P	94_E	0.566	0.41
43_D	63_Y	0.566	0.41
38_E	76_L	0.554	0.39
18_V	78_V	0.554	0.39
53_C	61_S	0.547	0.39
53_C	66_I	0.547	0.39
92_G	95_V	0.539	0.38
5_A	9_V	0.537	0.38
8_E	11_E	0.534	0.37
16_L	51_Y	0.531	0.37
43_D	47_G	0.531	0.37
31_L	64_G	0.531	0.37
44_V	47_G	0.530	0.37
19_G	27_P	0.526	0.37
92_G	99_L	0.522	0.36
41_E	44_V	0.518	0.36
20_F	59_G	0.511	0.35
27_P	52_Y	0.511	0.35
31_L	53_C	0.510	0.35
24_E	33_L	0.506	0.35
12_D	24_E	0.500	0.34

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4htiA	1	0.5238	4.6	0.921	Contact Map
2jn9A	1	0.3619	3.1	0.927	Contact Map
3t4rA	1	0.3619	3	0.928	Contact Map
2l55A	1	0.4286	2.7	0.929	Contact Map
3nreA	1	0.3905	1.9	0.935	Contact Map
3nqkA	2	0.5143	1.8	0.936	Contact Map
4besA	2	0.6762	1.7	0.936	Contact Map
3os7A	2	0.5143	1.7	0.937	Contact Map
4kmqA	1	0.9524	1.7	0.937	Contact Map
4av2A	3	0	1.7	0.937	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.