Imm53 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Imm53 - Immunity protein 53

PFAM:	PF15580	Sequences: LEWLQNWYASQCDGDWEHSYGIKIETLDNPGWSVKIDLAGTELEGRPFEEVKIERSEDDWLHCRVEDGKFEGAGGPLNLEEILEIFLDWAE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	91 (90)
Sequences:	2056 (1819)
Seq/√Len:	191.7
META:	0.914

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
3_W	87_L	3.994	1.00
74_G	82_I	3.458	1.00
75_G	78_N	2.694	1.00
72_G	82_I	2.674	1.00
59_D	78_N	2.538	1.00
35_K	69_K	2.370	1.00
43_L	90_A	2.170	1.00
48_F	63_C	2.031	1.00
64_R	71_E	1.938	1.00
78_N	81_E	1.860	1.00
20_Y	37_D	1.820	1.00
33_S	73_A	1.803	1.00
66_E	71_E	1.681	1.00
50_E	64_R	1.670	1.00
35_K	73_A	1.629	1.00
9_A	77_L	1.620	1.00
11_Q	42_E	1.612	1.00
4_L	83_L	1.564	1.00
37_D	69_K	1.530	1.00
23_K	35_K	1.516	1.00
34_V	82_I	1.470	1.00
84_E	88_D	1.462	1.00
61_L	81_E	1.437	1.00
55_R	59_D	1.428	1.00
24_I	34_V	1.404	1.00
55_R	78_N	1.360	1.00
45_G	68_G	1.344	1.00
35_K	71_E	1.340	1.00
13_D	17_E	1.330	1.00
50_E	62_H	1.241	1.00
39_A	68_G	1.233	1.00
25_E	33_S	1.230	1.00
55_R	81_E	1.228	1.00
18_H	29_N	1.217	1.00
63_C	72_G	1.215	1.00
53_I	81_E	1.206	1.00
44_E	68_G	1.202	1.00
52_K	62_H	1.189	1.00
53_I	61_L	1.184	1.00
7_W	11_Q	1.176	1.00
6_N	77_L	1.171	1.00
14_G	17_E	1.078	1.00
87_L	90_A	1.076	1.00
70_F	86_F	1.068	1.00
80_E	84_E	1.044	1.00
8_Y	12_C	1.037	1.00
27_L	33_S	1.017	1.00
75_G	81_E	0.998	1.00
63_C	85_I	0.970	0.99
64_R	73_A	0.962	0.99
18_H	28_D	0.953	0.99
7_W	36_I	0.927	0.99
22_I	32_W	0.925	0.99
46_R	89_W	0.920	0.99
51_V	63_C	0.918	0.99
2_E	5_Q	0.914	0.99
34_V	83_L	0.908	0.99
62_H	73_A	0.879	0.99
74_G	78_N	0.858	0.99
38_L	41_T	0.846	0.98
22_I	36_I	0.838	0.98
36_I	86_F	0.832	0.98
6_N	10_S	0.830	0.98
43_L	46_R	0.830	0.98
63_C	89_W	0.830	0.98
39_A	44_E	0.828	0.98
56_S	78_N	0.817	0.98
48_F	89_W	0.801	0.98
48_F	85_I	0.801	0.98
33_S	71_E	0.799	0.98
12_C	16_W	0.784	0.97
2_E	80_E	0.751	0.97
5_Q	80_E	0.750	0.97
19_S	40_G	0.746	0.96
27_L	73_A	0.746	0.96
20_Y	39_A	0.738	0.96
55_R	75_G	0.728	0.96
61_L	85_I	0.725	0.96
85_I	88_D	0.719	0.96
13_D	16_W	0.716	0.95
2_E	6_N	0.696	0.95
7_W	22_I	0.687	0.94
23_K	69_K	0.685	0.94
12_C	17_E	0.679	0.94
5_Q	79_L	0.674	0.94
41_T	45_G	0.647	0.92
18_H	21_G	0.646	0.92
8_Y	16_W	0.645	0.92
34_V	70_F	0.645	0.92
63_C	70_F	0.641	0.92
32_W	79_L	0.640	0.92
85_I	89_W	0.627	0.91
61_L	82_I	0.621	0.91
29_N	73_A	0.618	0.91
59_D	81_E	0.618	0.91
51_V	89_W	0.610	0.90
56_S	59_D	0.609	0.90
55_R	61_L	0.605	0.90
8_Y	27_L	0.603	0.89
15_D	19_S	0.603	0.89
48_F	51_V	0.601	0.89
8_Y	76_P	0.594	0.89
43_L	48_F	0.594	0.89
23_K	37_D	0.583	0.88
15_D	40_G	0.581	0.88
11_Q	40_G	0.578	0.87
20_Y	26_T	0.577	0.87
80_E	87_L	0.576	0.87
52_K	64_R	0.575	0.87
53_I	59_D	0.573	0.87
2_E	9_A	0.569	0.87
21_G	37_D	0.567	0.86
81_E	85_I	0.566	0.86
27_L	30_P	0.556	0.85
1_L	80_E	0.551	0.85
84_E	87_L	0.544	0.84
34_V	79_L	0.543	0.84
48_F	65_V	0.539	0.84
3_W	88_D	0.536	0.83
3_W	6_N	0.535	0.83
50_E	66_E	0.533	0.83
65_V	89_W	0.531	0.83
58_D	88_D	0.529	0.82
46_R	70_F	0.526	0.82
78_N	83_L	0.518	0.81
5_Q	59_D	0.518	0.81
22_I	25_E	0.514	0.81
11_Q	34_V	0.513	0.80
32_W	75_G	0.508	0.80
74_G	79_L	0.507	0.80
53_I	78_N	0.507	0.80
41_T	86_F	0.505	0.79
11_Q	36_I	0.503	0.79
59_D	75_G	0.502	0.79
51_V	85_I	0.500	0.79

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2m0jB	1	0.2637	7.9	0.924	Contact Map
2gw6A	2	0.3956	7.1	0.925	Contact Map
1x9mA	1	0.5385	5.6	0.929	Contact Map
1j5uA	1	0.6484	3.8	0.934	Contact Map
4ab7A	3	0.4945	3.7	0.935	Contact Map
3uw2A	1	0.6923	3.2	0.936	Contact Map
3encA	2	0.6593	3.1	0.937	Contact Map
4j8cA	2	0.1978	2.8	0.938	Contact Map
4es1A	2	0.6374	2.7	0.939	Contact Map
1gaiA	1	0.8681	2.5	0.94	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.