Imm17 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Imm17 - Immunity protein 17

PFAM:	PF15562	Sequences: LFFIAAGLFSLLGAIFNWDWFFNSRKAYKIRFFVKLFGRKGARIFYGLLGLLLIVLGVLLF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	61 (57)
Sequences:	1154 (976)
Seq/√Len:	129.2
META:	0.919

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_N	39_R	3.123	1.00
12_L	16_F	2.690	1.00
13_G	18_W	2.681	1.00
19_D	39_R	2.587	1.00
13_G	22_F	2.375	1.00
14_A	47_G	2.213	1.00
7_G	50_G	1.969	1.00
37_F	41_G	1.948	1.00
12_L	18_W	1.830	1.00
11_L	47_G	1.730	1.00
55_V	59_L	1.729	1.00
14_A	50_G	1.693	1.00
48_L	52_L	1.683	1.00
4_I	54_I	1.528	1.00
11_L	15_I	1.505	1.00
32_F	36_L	1.485	1.00
34_V	42_A	1.474	1.00
19_D	23_N	1.346	1.00
13_G	21_F	1.223	1.00
4_I	57_G	1.152	0.99
7_G	57_G	1.148	0.99
17_N	47_G	1.142	0.99
21_F	46_Y	1.097	0.99
41_G	45_F	1.087	0.99
40_K	44_I	1.074	0.99
17_N	43_R	1.043	0.98
7_G	14_A	1.037	0.98
1_L	5_A	1.015	0.98
10_S	21_F	1.011	0.98
32_F	35_K	1.003	0.98
11_L	50_G	0.982	0.98
53_L	56_L	0.977	0.98
10_S	24_S	0.975	0.98
14_A	22_F	0.943	0.97
5_A	9_F	0.918	0.96
11_L	54_I	0.918	0.96
13_G	16_F	0.869	0.95
22_F	42_A	0.855	0.95
44_I	47_G	0.837	0.94
8_L	48_L	0.823	0.94
42_A	46_Y	0.793	0.92
40_K	43_R	0.784	0.92
46_Y	50_G	0.781	0.92
7_G	21_F	0.779	0.92
39_R	43_R	0.762	0.91
11_L	14_A	0.734	0.89
19_D	40_K	0.724	0.88
9_F	20_W	0.712	0.88
2_F	31_R	0.686	0.86
51_L	54_I	0.670	0.84
17_N	20_W	0.667	0.84
56_L	59_L	0.661	0.83
33_F	38_G	0.660	0.83
12_L	38_G	0.658	0.83
11_L	51_L	0.653	0.83
38_G	52_L	0.652	0.83
22_F	39_R	0.650	0.82
2_F	7_G	0.646	0.82
14_A	17_N	0.645	0.82
15_I	47_G	0.635	0.81
27_A	45_F	0.630	0.80
51_L	59_L	0.598	0.77
12_L	15_I	0.592	0.76
5_A	55_V	0.591	0.76
2_F	54_I	0.589	0.76
27_A	46_Y	0.584	0.75
26_K	41_G	0.576	0.74
17_N	22_F	0.570	0.74
17_N	34_V	0.569	0.73
31_R	34_V	0.568	0.73
9_F	16_F	0.561	0.72
34_V	37_F	0.558	0.72
3_F	53_L	0.556	0.72
31_R	35_K	0.553	0.71
33_F	37_F	0.548	0.71
33_F	40_K	0.541	0.70
10_S	50_G	0.536	0.69
46_Y	49_L	0.526	0.68
12_L	20_W	0.522	0.67
34_V	56_L	0.519	0.66
47_G	52_L	0.516	0.66
26_K	46_Y	0.509	0.65
18_W	22_F	0.509	0.65
5_A	25_R	0.505	0.64
3_F	57_G	0.504	0.64
45_F	48_L	0.500	0.64

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2zxeB	1	0.377	16.8	0.798	Contact Map
3wguB	1	0.7049	5.4	0.838	Contact Map
4tq3A	1	0.9672	3.2	0.855	Contact Map
3pe5A	1	0	3.1	0.856	Contact Map
4httA	1	0.4426	2.9	0.858	Contact Map
4nv5A	1	0.4262	2.8	0.859	Contact Map
4b4aA	1	0.4426	2.7	0.86	Contact Map
4od4A	1	0.9672	2.6	0.861	Contact Map
2ww8A	1	0	2.5	0.864	Contact Map
3ixzB	1	0.3607	2.1	0.868	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0043 seconds.