Abhydrolase_9_N - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Abhydrolase_9_N - Alpha/beta-hydrolase family N-terminus

PFAM:	PF15420	Sequences: LTPSLLPRGWLFQGVLSGISAAIGYGLGVLLAWLWRYLERLPRPSPRARRRAWLVLAVAAAVLAVLFLWLAARWQNSIRALMGMEPVDTADPLLVLLVALVVFALLLALGRLLRRLVRFLARLLGRFLPRRVARVVGVVLVVVLFWLLVNGVLVRGALRAADSSFAAVDALTEPGVPQPTSPLRSGSPASLVSWDSLGRQGRRFVASGP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	209 (208)
Sequences:	2514 (1866)
Seq/√Len:	129.4
META:	0.71

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
193_S	196_S	6.732	1.00
197_L	205_V	3.838	1.00
157_A	161_A	3.361	1.00
200_Q	203_R	3.311	1.00
184_R	208_G	3.258	1.00
172_T	175_G	2.953	1.00
76_N	79_R	2.564	1.00
173_E	203_R	2.439	1.00
30_L	33_W	2.433	1.00
154_V	158_L	2.336	1.00
54_L	58_V	2.318	1.00
78_I	82_M	2.177	1.00
79_R	87_V	2.160	1.00
115_R	119_F	2.107	1.00
80_A	86_P	2.103	1.00
119_F	123_L	2.041	1.00
156_G	160_A	2.000	1.00
76_N	87_V	1.949	1.00
24_G	28_G	1.910	1.00
146_W	150_N	1.909	1.00
36_R	43_R	1.891	1.00
10_W	94_L	1.883	1.00
113_L	145_F	1.817	1.00
9_G	12_F	1.813	1.00
181_S	187_S	1.805	1.00
182_P	187_S	1.787	1.00
21_A	103_F	1.752	1.00
110_G	114_R	1.709	1.00
123_L	127_F	1.694	1.00
14_G	98_V	1.679	1.00
77_S	80_A	1.676	1.00
72_A	76_N	1.666	1.00
47_R	51_R	1.655	1.00
72_A	91_D	1.645	1.00
26_G	110_G	1.640	1.00
157_A	160_A	1.639	1.00
123_L	126_R	1.632	1.00
89_T	92_P	1.618	1.00
19_I	106_L	1.594	1.00
143_V	147_L	1.592	1.00
22_A	26_G	1.568	1.00
132_V	135_V	1.556	1.00
168_V	200_Q	1.538	1.00
198_G	201_G	1.536	1.00
51_R	54_L	1.531	1.00
121_A	137_G	1.527	1.00
11_L	16_L	1.526	1.00
130_R	134_R	1.507	1.00
50_R	54_L	1.485	1.00
183_L	187_S	1.473	1.00
14_G	18_G	1.453	1.00
128_L	132_V	1.443	1.00
125_G	133_A	1.428	1.00
141_V	145_F	1.426	1.00
107_L	111_R	1.416	1.00
35_W	41_L	1.413	1.00
18_G	22_A	1.403	1.00
113_L	141_V	1.397	1.00
147_L	150_N	1.387	1.00
172_T	176_V	1.383	1.00
137_G	141_V	1.360	1.00
91_D	94_L	1.347	1.00
112_L	116_L	1.314	1.00
87_V	91_D	1.309	1.00
38_L	135_V	1.308	1.00
155_R	159_R	1.296	1.00
4_S	12_F	1.286	1.00
53_W	56_L	1.273	1.00
17_S	99_A	1.271	1.00
148_L	152_V	1.267	1.00
13_Q	17_S	1.266	1.00
88_D	91_D	1.246	1.00
32_A	36_R	1.246	1.00
10_W	98_V	1.239	1.00
22_A	107_L	1.226	1.00
49_R	53_W	1.223	1.00
128_L	136_V	1.218	1.00
53_W	57_A	1.203	0.99
51_R	55_V	1.195	0.99
201_G	204_F	1.193	0.99
121_A	125_G	1.192	0.99
112_L	115_R	1.175	0.99
14_G	99_A	1.168	0.99
186_G	191_L	1.164	0.99
113_L	117_V	1.162	0.99
125_G	130_R	1.161	0.99
197_L	202_R	1.160	0.99
39_E	130_R	1.158	0.99
62_V	66_L	1.154	0.99
171_L	199_R	1.146	0.99
125_G	134_R	1.116	0.99
54_L	57_A	1.114	0.99
75_Q	78_I	1.114	0.99
103_F	107_L	1.111	0.99
176_V	203_R	1.093	0.99
39_E	42_P	1.093	0.99
45_S	48_A	1.067	0.99
117_V	121_A	1.063	0.99
67_F	71_A	1.048	0.98
72_A	89_T	1.042	0.98
95_V	98_V	1.041	0.98
134_R	137_G	1.040	0.98
124_L	127_F	1.035	0.98
16_L	21_A	1.034	0.98
105_L	109_L	1.028	0.98
26_G	29_V	1.026	0.98
55_V	58_V	1.018	0.98
64_A	67_F	1.013	0.98
70_L	73_R	0.997	0.98
68_L	95_V	0.985	0.98
101_V	105_L	0.977	0.98
116_L	119_F	0.973	0.98
76_N	86_P	0.972	0.98
1_L	17_S	0.968	0.97
35_W	39_E	0.961	0.97
37_Y	131_R	0.951	0.97
14_G	102_V	0.951	0.97
161_A	165_F	0.950	0.97
32_A	43_R	0.948	0.97
59_A	63_L	0.945	0.97
124_L	128_L	0.931	0.97
183_L	188_P	0.927	0.97
94_L	97_L	0.914	0.96
172_T	203_R	0.907	0.96
35_W	42_P	0.903	0.96
163_S	166_A	0.900	0.96
149_V	153_L	0.899	0.96
173_E	199_R	0.896	0.96
52_A	55_V	0.887	0.96
61_A	65_V	0.874	0.95
29_V	33_W	0.871	0.95
150_N	155_R	0.869	0.95
178_Q	187_S	0.863	0.95
173_E	200_Q	0.860	0.95
142_V	145_F	0.860	0.95
120_L	124_L	0.854	0.95
13_Q	20_S	0.848	0.95
34_L	37_Y	0.847	0.95
181_S	184_R	0.843	0.94
69_W	93_L	0.841	0.94
161_A	164_S	0.835	0.94
12_F	16_L	0.831	0.94
12_F	15_V	0.830	0.94
20_S	23_I	0.828	0.94
135_V	139_V	0.827	0.94
29_V	32_A	0.826	0.94
169_D	193_S	0.825	0.94
114_R	117_V	0.818	0.93
65_V	69_W	0.817	0.93
14_G	17_S	0.812	0.93
18_G	102_V	0.809	0.93
151_G	202_R	0.808	0.93
44_P	48_A	0.804	0.93
129_P	132_V	0.803	0.93
162_D	165_F	0.802	0.93
119_F	122_R	0.801	0.93
128_L	133_A	0.798	0.93
87_V	92_P	0.797	0.93
140_L	144_L	0.787	0.92
149_V	154_V	0.779	0.92
117_V	137_G	0.777	0.92
200_Q	206_A	0.776	0.92
109_L	112_L	0.773	0.91
186_G	190_S	0.771	0.91
159_R	163_S	0.770	0.91
73_R	76_N	0.767	0.91
45_S	109_L	0.767	0.91
182_P	189_A	0.767	0.91
199_R	206_A	0.763	0.91
157_A	164_S	0.759	0.91
72_A	92_P	0.756	0.90
48_A	51_R	0.749	0.90
11_L	14_G	0.746	0.90
14_G	155_R	0.742	0.90
95_V	99_A	0.742	0.90
145_F	149_V	0.741	0.90
57_A	61_A	0.741	0.90
136_V	140_L	0.735	0.89
164_S	167_A	0.724	0.88
2_T	74_W	0.713	0.88
117_V	154_V	0.712	0.88
180_T	189_A	0.710	0.88
65_V	101_V	0.707	0.87
4_S	124_L	0.705	0.87
173_E	176_V	0.700	0.87
72_A	87_V	0.700	0.87
152_V	156_G	0.697	0.87
193_S	197_L	0.696	0.86
176_V	206_A	0.693	0.86
92_P	95_V	0.688	0.86
185_S	192_V	0.685	0.86
79_R	84_M	0.683	0.85
48_A	52_A	0.679	0.85
80_A	140_L	0.679	0.85
190_S	201_G	0.679	0.85
58_V	61_A	0.675	0.85
13_Q	79_R	0.675	0.85
91_D	95_V	0.675	0.85
67_F	70_L	0.667	0.84
197_L	200_Q	0.666	0.84
172_T	200_Q	0.665	0.84
158_L	162_D	0.665	0.84
32_A	49_R	0.665	0.84
31_L	44_P	0.664	0.84
113_L	116_L	0.662	0.84
26_G	30_L	0.662	0.84
113_L	146_W	0.658	0.83
108_A	112_L	0.656	0.83
104_A	108_A	0.653	0.83
192_V	196_S	0.651	0.83
168_V	174_P	0.650	0.83
78_I	131_R	0.645	0.82
59_A	62_V	0.645	0.82
71_A	78_I	0.636	0.81
46_P	50_R	0.636	0.81
1_L	32_A	0.634	0.81
120_L	141_V	0.629	0.80
4_S	8_R	0.623	0.80
4_S	15_V	0.619	0.79
182_P	205_V	0.617	0.79
74_W	79_R	0.616	0.79
120_L	177_P	0.616	0.79
8_R	13_Q	0.616	0.79
1_L	95_V	0.616	0.79
98_V	101_V	0.615	0.79
200_Q	207_S	0.615	0.79
156_G	159_R	0.615	0.79
19_I	36_R	0.612	0.79
21_A	165_F	0.608	0.78
55_V	59_A	0.608	0.78
102_V	157_A	0.607	0.78
145_F	148_L	0.607	0.78
172_T	202_R	0.607	0.78
86_P	108_A	0.606	0.78
168_V	186_G	0.605	0.78
183_L	186_G	0.605	0.78
96_L	152_V	0.604	0.78
13_Q	169_D	0.602	0.77
122_R	130_R	0.600	0.77
17_S	23_I	0.598	0.77
194_W	205_V	0.593	0.76
58_V	62_V	0.593	0.76
151_G	172_T	0.590	0.76
6_L	82_M	0.589	0.76
157_A	162_D	0.586	0.76
13_Q	16_L	0.586	0.76
89_T	94_L	0.584	0.75
150_N	154_V	0.583	0.75
69_W	127_F	0.583	0.75
44_P	47_R	0.582	0.75
57_A	82_M	0.577	0.74
180_T	183_L	0.576	0.74
116_L	123_L	0.575	0.74
33_W	37_Y	0.570	0.74
12_F	27_L	0.569	0.73
89_T	93_L	0.566	0.73
96_L	185_S	0.565	0.73
12_F	20_S	0.562	0.73
147_L	151_G	0.560	0.72
114_R	118_R	0.560	0.72
168_V	171_L	0.560	0.72
85_E	88_D	0.560	0.72
162_D	166_A	0.559	0.72
129_P	134_R	0.558	0.72
6_L	169_D	0.557	0.72
90_A	109_L	0.557	0.72
67_F	77_S	0.557	0.72
93_L	97_L	0.556	0.72
176_V	199_R	0.555	0.72
65_V	70_L	0.555	0.72
194_W	198_G	0.554	0.71
139_V	142_V	0.544	0.70
109_L	139_V	0.544	0.70
23_I	31_L	0.543	0.70
25_Y	28_G	0.543	0.70
144_L	147_L	0.542	0.70
194_W	199_R	0.541	0.70
94_L	98_V	0.540	0.70
22_A	106_L	0.540	0.70
15_V	94_L	0.538	0.69
97_L	101_V	0.538	0.69
151_G	156_G	0.537	0.69
66_L	70_L	0.537	0.69
5_L	34_L	0.535	0.69
74_W	194_W	0.529	0.68
199_R	203_R	0.525	0.67
203_R	207_S	0.524	0.67
190_S	198_G	0.523	0.67
84_M	158_L	0.523	0.67
173_E	192_V	0.523	0.67
204_F	207_S	0.522	0.67
102_V	197_L	0.522	0.67
13_Q	18_G	0.519	0.67
15_V	38_L	0.518	0.66
137_G	149_V	0.518	0.66
37_Y	136_V	0.518	0.66
164_S	168_V	0.518	0.66
55_V	62_V	0.516	0.66
126_R	208_G	0.516	0.66
57_A	158_L	0.516	0.66
68_L	191_L	0.516	0.66
18_G	78_I	0.515	0.66
14_G	21_A	0.512	0.65
89_T	140_L	0.509	0.65
56_L	116_L	0.508	0.65
68_L	89_T	0.508	0.65
20_S	71_A	0.508	0.65
31_L	143_V	0.507	0.65
61_A	157_A	0.507	0.65
116_L	141_V	0.503	0.64
6_L	32_A	0.501	0.64
26_G	114_R	0.500	0.64

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1zeeA	3	0.2679	5.2	0.953	Contact Map
4eneA	2	0.6411	3.6	0.957	Contact Map
2fcgF	1	0.1196	2.5	0.96	Contact Map
2auhB	1	0.0957	2.1	0.962	Contact Map
1fryA	1	0.1388	1.8	0.963	Contact Map
3rqwA	4	0.3301	1.3	0.966	Contact Map
1pw4A	1	0.3828	1.3	0.966	Contact Map
3bz1X	1	0.177	1.1	0.967	Contact Map
4cofA	3	0.3445	1.1	0.967	Contact Map
2kt5B	1	0.1053	1.1	0.968	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.