SLX9 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SLX9 - Ribosome biogenesis protein SLX9

PFAM:	PF15341	Sequences: SFRLSKKEKRKLKHEAFLSKIEAISKSAEKKKKKRARRPAKKLVGDLDSLADALPEEAEGAKGRPQAQVGKIKKPEKSLKSRPGAAKRKKKLVEEERERFQKVLAHPAFQANPLAAIRQHLSNT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	124 (118)
Sequences:	603 (469)
Seq/√Len:	43.2
META:	0.207

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
96_E	99_R	3.139	1.00
5_S	8_E	3.097	1.00
120_H	123_N	2.720	1.00
86_A	89_K	2.441	1.00
31_K	34_K	2.268	1.00
38_R	44_V	2.148	1.00
84_G	88_R	2.113	0.99
27_S	31_K	2.108	0.99
28_A	32_K	2.051	0.99
27_S	30_K	2.038	0.99
14_H	18_L	2.024	0.99
103_V	109_F	1.969	0.99
87_K	91_K	1.912	0.99
114_L	117_I	1.889	0.99
109_F	113_P	1.883	0.99
20_K	33_K	1.852	0.99
25_S	31_K	1.787	0.98
11_K	15_E	1.760	0.98
25_S	35_R	1.742	0.98
11_K	17_F	1.731	0.98
108_A	111_A	1.643	0.97
87_K	121_L	1.636	0.97
60_G	64_R	1.599	0.96
58_A	61_A	1.576	0.96
25_S	34_K	1.555	0.96
82_R	85_A	1.513	0.95
119_Q	123_N	1.482	0.94
68_Q	71_K	1.450	0.94
107_P	116_A	1.443	0.94
117_I	121_L	1.414	0.93
70_G	73_K	1.413	0.93
93_V	97_R	1.327	0.90
39_P	43_L	1.327	0.90
4_L	19_S	1.313	0.90
106_H	109_F	1.303	0.89
77_K	80_K	1.281	0.89
27_S	34_K	1.275	0.88
37_R	41_K	1.270	0.88
17_F	21_I	1.268	0.88
83_P	87_K	1.268	0.88
8_E	12_L	1.267	0.88
15_E	18_L	1.263	0.88
85_A	88_R	1.252	0.87
103_V	113_P	1.212	0.86
82_R	91_K	1.187	0.85
45_G	53_A	1.171	0.84
118_R	121_L	1.167	0.83
63_G	66_Q	1.148	0.82
38_R	41_K	1.143	0.82
4_L	12_L	1.133	0.82
5_S	9_K	1.122	0.81
60_G	107_P	1.118	0.81
38_R	43_L	1.116	0.81
112_N	120_H	1.085	0.79
98_E	102_K	1.076	0.78
6_K	9_K	1.072	0.78
93_V	103_V	1.058	0.77
41_K	87_K	1.038	0.76
101_Q	114_L	1.034	0.75
13_K	17_F	1.011	0.74
103_V	120_H	1.004	0.73
58_A	62_K	1.000	0.73
103_V	106_H	0.994	0.72
50_L	81_S	0.982	0.71
61_A	66_Q	0.973	0.71
46_D	49_S	0.972	0.71
120_H	124_T	0.960	0.70
90_K	94_E	0.950	0.69
107_P	120_H	0.940	0.68
83_P	88_R	0.934	0.68
3_R	11_K	0.929	0.67
17_F	92_L	0.926	0.67
6_K	21_I	0.918	0.66
25_S	29_E	0.914	0.66
106_H	123_N	0.914	0.66
7_K	21_I	0.905	0.65
69_V	74_K	0.883	0.63
110_Q	119_Q	0.872	0.62
112_N	122_S	0.868	0.62
30_K	34_K	0.867	0.62
78_S	84_G	0.867	0.62
9_K	70_G	0.858	0.61
85_A	89_K	0.854	0.61
41_K	49_S	0.853	0.60
65_P	68_Q	0.850	0.60
86_A	93_V	0.837	0.59
103_V	116_A	0.836	0.59
61_A	65_P	0.834	0.59
112_N	115_A	0.830	0.58
65_P	73_K	0.827	0.58
32_K	100_F	0.821	0.57
56_E	107_P	0.817	0.57
6_K	99_R	0.817	0.57
60_G	65_P	0.814	0.57
58_A	64_R	0.810	0.56
47_L	79_L	0.810	0.56
92_L	96_E	0.809	0.56
99_R	121_L	0.807	0.56
19_S	97_R	0.802	0.56
95_E	99_R	0.802	0.56
87_K	92_L	0.795	0.55
99_R	103_V	0.780	0.54
100_F	121_L	0.778	0.53
67_A	71_K	0.777	0.53
71_K	77_K	0.770	0.53
79_L	100_F	0.765	0.52
25_S	30_K	0.754	0.51
113_P	121_L	0.750	0.51
49_S	118_R	0.748	0.51
11_K	62_K	0.742	0.50
8_E	43_L	0.742	0.50
20_K	64_R	0.741	0.50
115_A	119_Q	0.732	0.49
59_E	63_G	0.727	0.49
116_A	120_H	0.709	0.47
106_H	116_A	0.708	0.47
84_G	87_K	0.707	0.47
65_P	74_K	0.702	0.46
101_Q	110_Q	0.702	0.46
101_Q	105_A	0.699	0.46
97_R	100_F	0.694	0.45
54_L	100_F	0.681	0.44
60_G	67_A	0.676	0.44
64_R	68_Q	0.674	0.44
7_K	16_A	0.667	0.43
89_K	112_N	0.662	0.42
63_G	68_Q	0.656	0.42
6_K	55_P	0.655	0.42
18_L	94_E	0.652	0.42
52_D	55_P	0.652	0.42
14_H	120_H	0.649	0.41
33_K	37_R	0.647	0.41
17_F	22_E	0.647	0.41
59_E	67_A	0.638	0.40
78_S	90_K	0.634	0.40
114_L	118_R	0.626	0.39
101_Q	104_L	0.625	0.39
43_L	54_L	0.620	0.39
19_S	53_A	0.619	0.38
9_K	114_L	0.617	0.38
106_H	120_H	0.602	0.37
3_R	120_H	0.601	0.37
28_A	31_K	0.596	0.36
5_S	111_A	0.592	0.36
60_G	66_Q	0.591	0.36
56_E	73_K	0.582	0.35
70_G	77_K	0.582	0.35
21_I	55_P	0.577	0.35
47_L	53_A	0.575	0.35
50_L	55_P	0.575	0.35
67_A	112_N	0.574	0.35
82_R	88_R	0.572	0.34
79_L	82_R	0.571	0.34
79_L	89_K	0.564	0.34
60_G	70_G	0.564	0.34
103_V	110_Q	0.558	0.33
13_K	45_G	0.555	0.33
68_Q	72_I	0.554	0.33
99_R	102_K	0.540	0.32
25_S	53_A	0.537	0.31
39_P	42_K	0.535	0.31
96_E	116_A	0.533	0.31
15_E	94_E	0.527	0.31
30_K	49_S	0.524	0.30
63_G	90_K	0.522	0.30
11_K	48_D	0.520	0.30
35_R	118_R	0.518	0.30
20_K	32_K	0.514	0.30
116_A	119_Q	0.513	0.29
4_L	49_S	0.512	0.29
119_Q	122_S	0.510	0.29
112_N	118_R	0.510	0.29
59_E	62_K	0.509	0.29
56_E	72_I	0.506	0.29
43_L	99_R	0.504	0.29
33_K	63_G	0.501	0.29
52_D	103_V	0.500	0.28

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2lnmA	1	0.2984	7.6	0.911	Contact Map
1zxaA	1	0.2903	7.2	0.911	Contact Map
2llwA	1	0.3629	3.6	0.923	Contact Map
3gjxB	1	0.6371	2.8	0.927	Contact Map
3t98A	4	0.129	2.8	0.927	Contact Map
1a93A	1	0.1935	2.6	0.928	Contact Map
4ivgA	4	0.4113	2.6	0.929	Contact Map
3t0hA	2	0.2984	2.4	0.929	Contact Map
4r39A	1	0.2581	2.3	0.93	Contact Map
4nejA	1	0.629	2	0.933	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.