DUF4491 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF4491 - Domain of unknown function (DUF4491)

PFAM:	PF14898	Sequences: NFTGLIIGLATFLIIGLFHPIVIKGEYYFGTKCWWVFLLLGIALIAASLFIENVILSALLGVFGFSLLWSIGELFEQEKRVEKGWFPKNPKR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	92 (92)
Sequences:	2137 (1406)
Seq/√Len:	146.6
META:	0.927

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
79_K	82_E	3.482	1.00
31_T	78_E	3.330	1.00
25_G	33_C	2.969	1.00
10_A	59_L	2.864	1.00
44_L	63_F	2.681	1.00
40_L	67_L	2.083	1.00
18_F	67_L	2.058	1.00
51_I	60_L	2.052	1.00
31_T	75_F	2.051	1.00
72_G	76_E	2.031	1.00
29_F	33_C	1.931	1.00
89_N	92_R	1.756	1.00
18_F	70_S	1.750	1.00
28_Y	89_N	1.716	1.00
78_E	82_E	1.691	1.00
38_L	42_I	1.679	1.00
11_T	62_V	1.649	1.00
8_G	65_F	1.631	1.00
25_G	29_F	1.612	1.00
53_N	56_L	1.556	1.00
34_W	75_F	1.532	1.00
45_I	64_G	1.505	1.00
51_I	56_L	1.461	1.00
47_A	60_L	1.398	1.00
45_I	68_L	1.362	1.00
63_F	67_L	1.343	1.00
24_K	28_Y	1.342	1.00
7_I	58_A	1.336	1.00
2_F	6_I	1.304	1.00
25_G	37_F	1.272	1.00
44_L	67_L	1.241	1.00
75_F	78_E	1.232	1.00
82_E	88_K	1.217	1.00
33_C	36_V	1.216	1.00
18_F	21_I	1.148	1.00
67_L	70_S	1.123	0.99
7_I	55_I	1.110	0.99
14_I	63_F	1.097	0.99
46_A	50_F	1.083	0.99
18_F	63_F	1.083	0.99
64_G	68_L	1.066	0.99
54_V	58_A	1.065	0.99
3_T	54_V	1.059	0.99
35_W	74_L	1.051	0.99
77_Q	80_R	1.038	0.99
6_I	55_I	1.034	0.99
44_L	47_A	1.028	0.99
25_G	70_S	1.016	0.99
73_E	77_Q	0.995	0.99
38_L	71_I	0.990	0.99
14_I	76_E	0.987	0.99
57_S	61_G	0.981	0.98
17_L	21_I	0.976	0.98
79_K	83_K	0.971	0.98
29_F	36_V	0.948	0.98
43_A	47_A	0.909	0.97
3_T	55_I	0.905	0.97
18_F	66_S	0.895	0.97
11_T	15_I	0.881	0.97
44_L	60_L	0.875	0.97
21_I	70_S	0.873	0.97
25_G	74_L	0.872	0.97
72_G	79_K	0.866	0.97
34_W	38_L	0.855	0.96
47_A	50_F	0.824	0.96
8_G	68_L	0.816	0.95
23_I	86_F	0.809	0.95
19_H	22_V	0.806	0.95
3_T	6_I	0.804	0.95
76_E	79_K	0.799	0.95
21_I	37_F	0.782	0.94
6_I	9_L	0.776	0.94
21_I	58_A	0.767	0.93
23_I	70_S	0.767	0.93
48_S	58_A	0.754	0.93
26_E	78_E	0.738	0.92
16_G	20_P	0.731	0.92
46_A	54_V	0.723	0.91
16_G	19_H	0.717	0.91
4_G	61_G	0.715	0.91
44_L	64_G	0.705	0.90
26_E	34_W	0.701	0.90
69_W	73_E	0.696	0.90
56_L	59_L	0.691	0.89
78_E	88_K	0.681	0.89
73_E	80_R	0.680	0.89
42_I	46_A	0.675	0.88
33_C	74_L	0.670	0.88
10_A	14_I	0.664	0.87
9_L	54_V	0.661	0.87
26_E	31_T	0.661	0.87
17_L	42_I	0.659	0.87
13_L	17_L	0.655	0.87
21_I	25_G	0.655	0.87
12_F	20_P	0.650	0.86
17_L	20_P	0.646	0.86
10_A	55_I	0.646	0.86
23_I	66_S	0.643	0.86
7_I	62_V	0.640	0.85
24_K	30_G	0.635	0.85
30_G	34_W	0.629	0.84
81_V	85_W	0.624	0.84
43_A	50_F	0.623	0.84
52_E	57_S	0.622	0.84
27_Y	37_F	0.619	0.83
5_L	48_S	0.613	0.83
39_L	43_A	0.603	0.82
22_V	70_S	0.602	0.82
16_G	30_G	0.592	0.81
16_G	22_V	0.592	0.81
22_V	66_S	0.592	0.81
21_I	67_L	0.586	0.80
47_A	51_I	0.581	0.79
18_F	40_L	0.575	0.79
88_K	92_R	0.575	0.79
43_A	46_A	0.572	0.78
11_T	54_V	0.564	0.77
65_F	68_L	0.564	0.77
63_F	66_S	0.561	0.77
71_I	86_F	0.557	0.77
27_Y	48_S	0.554	0.76
11_T	14_I	0.545	0.75
25_G	30_G	0.544	0.75
4_G	57_S	0.536	0.74
72_G	75_F	0.532	0.73
1_N	4_G	0.528	0.73
64_G	69_W	0.526	0.72
45_I	58_A	0.524	0.72
27_Y	84_G	0.522	0.72
81_V	84_G	0.518	0.71
10_A	13_L	0.517	0.71
59_L	63_F	0.514	0.71
35_W	64_G	0.511	0.70
40_L	44_L	0.510	0.70
1_N	52_E	0.508	0.70
83_K	86_F	0.507	0.70
12_F	15_I	0.503	0.69
23_I	30_G	0.500	0.69

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2wjnM	1	0.8913	12.1	0.927	Contact Map
1fftA	1	0.9674	6.6	0.935	Contact Map
1eysL	1	0.8587	6.4	0.936	Contact Map
3tx3A	2	0.8478	6.3	0.936	Contact Map
3dh4A	3	0.913	5.7	0.937	Contact Map
3l1lA	2	0.913	5.7	0.937	Contact Map
4wgvA	2	0.9239	5.6	0.937	Contact Map
2gsmA	1	0.9565	5.4	0.938	Contact Map
2yevA	1	0.9348	5	0.939	Contact Map
1m56C	2	0.75	4.8	0.939	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.