PHM7_cyt - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PHM7_cyt - Cytosolic domain of 10TM putative phosphate transporter

PFAM:	PF14703	Sequences: IVRDVKELPKLVEERDKAVRKLEYAEAKYLKNANKLRLKALKKGKKPKRPTHRTGFLGLFGKKVDAIDYYTEELKRLN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	78 (77)
Sequences:	2008 (1333)
Seq/√Len:	151.9
META:	0.305

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
73_E	76_R	4.653	1.00
52_H	66_A	4.472	1.00
49_R	65_D	3.502	1.00
18_A	74_L	2.855	1.00
66_A	70_Y	2.449	1.00
37_R	41_L	2.199	1.00
26_E	71_T	1.639	1.00
25_A	66_A	1.604	1.00
5_V	9_P	1.534	1.00
12_V	16_D	1.508	1.00
58_G	61_G	1.508	1.00
23_E	27_A	1.505	1.00
71_T	75_K	1.439	1.00
40_A	44_G	1.402	1.00
40_A	43_K	1.384	1.00
54_T	60_F	1.365	1.00
44_G	47_P	1.348	1.00
41_L	47_P	1.325	1.00
14_E	73_E	1.311	1.00
42_K	45_K	1.299	1.00
55_G	58_G	1.288	1.00
18_A	70_Y	1.281	1.00
56_F	60_F	1.262	1.00
14_E	77_L	1.248	1.00
29_Y	67_I	1.240	1.00
41_L	44_G	1.201	1.00
14_E	76_R	1.151	1.00
38_L	42_K	1.147	1.00
37_R	40_A	1.139	1.00
34_N	37_R	1.138	1.00
40_A	45_K	1.124	1.00
72_E	76_R	1.121	0.99
15_R	26_E	1.117	0.99
43_K	46_K	1.116	0.99
32_N	36_L	1.061	0.99
2_V	5_V	1.053	0.99
29_Y	33_A	1.012	0.99
19_V	74_L	1.010	0.99
19_V	23_E	0.985	0.99
38_L	46_K	0.974	0.99
18_A	77_L	0.963	0.98
52_H	64_V	0.961	0.98
30_L	34_N	0.961	0.98
72_E	75_K	0.951	0.98
50_P	67_I	0.951	0.98
26_E	29_Y	0.937	0.98
39_K	46_K	0.926	0.98
11_L	14_E	0.925	0.98
15_R	19_V	0.916	0.98
38_L	44_G	0.911	0.98
6_K	9_P	0.903	0.98
41_L	46_K	0.894	0.98
65_D	68_D	0.894	0.98
9_P	13_E	0.890	0.97
39_K	42_K	0.886	0.97
24_Y	28_K	0.879	0.97
17_K	28_K	0.878	0.97
42_K	47_P	0.862	0.97
41_L	45_K	0.856	0.97
40_A	47_P	0.835	0.96
51_T	63_K	0.835	0.96
66_A	69_Y	0.826	0.96
16_D	20_R	0.790	0.95
43_K	47_P	0.787	0.95
55_G	59_L	0.780	0.95
11_L	77_L	0.775	0.94
40_A	46_K	0.757	0.94
38_L	43_K	0.751	0.93
26_E	31_K	0.742	0.93
30_L	63_K	0.727	0.92
35_K	38_L	0.710	0.91
14_E	18_A	0.710	0.91
38_L	41_L	0.709	0.91
5_V	20_R	0.701	0.91
54_T	61_G	0.700	0.91
13_E	17_K	0.686	0.90
39_K	43_K	0.671	0.89
16_D	19_V	0.670	0.89
22_L	65_D	0.663	0.88
5_V	74_L	0.657	0.88
52_H	70_Y	0.652	0.87
49_R	68_D	0.643	0.87
74_L	77_L	0.642	0.87
34_N	38_L	0.631	0.86
42_K	46_K	0.626	0.85
52_H	69_Y	0.625	0.85
21_K	70_Y	0.615	0.84
2_V	71_T	0.614	0.84
68_D	72_E	0.612	0.84
64_V	76_R	0.607	0.83
10_K	13_E	0.606	0.83
22_L	67_I	0.602	0.83
16_D	31_K	0.588	0.81
31_K	34_N	0.580	0.81
5_V	69_Y	0.564	0.79
22_L	74_L	0.557	0.78
53_R	63_K	0.557	0.78
32_N	35_K	0.552	0.77
5_V	19_V	0.544	0.76
20_R	41_L	0.535	0.75
2_V	15_R	0.535	0.75
1_I	23_E	0.534	0.75
53_R	56_F	0.534	0.75
2_V	9_P	0.526	0.74
68_D	75_K	0.523	0.73
36_L	40_A	0.520	0.73
8_L	23_E	0.515	0.72
12_V	19_V	0.513	0.72
57_L	60_F	0.513	0.72
9_P	20_R	0.512	0.72
35_K	42_K	0.507	0.71
23_E	26_E	0.507	0.71
2_V	26_E	0.506	0.71
28_K	48_K	0.505	0.71
3_R	9_P	0.502	0.70
4_D	15_R	0.500	0.70

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1l8dA	2	0.7308	10.4	0.865	Contact Map
1fsuA	1	0.7308	8.5	0.87	Contact Map
4fzsA	2	0.7564	4.3	0.886	Contact Map
4upkA	3	0.6923	3.8	0.89	Contact Map
2k4nA	1	0.3333	3.7	0.89	Contact Map
3ghgA	2	0.9487	3.6	0.89	Contact Map
2qzuA	2	0.5513	3.5	0.892	Contact Map
1xe1A	2	0.1154	3.3	0.892	Contact Map
2e52A	2	1	3.2	0.893	Contact Map
4uqzB	1	0	3.2	0.894	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0043 seconds.