SnAC - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SnAC - Snf2-ATP coupling, chromatin remodelling complex

PFAM:	PF14619	Sequences: ERRREEAEEWDEEGGKGKPRPPRLMEEDELPEWYLKDDNEEEEEEKEEEEEEEYGRGARERKEVKYDDGLTEEQWL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	76 (74)
Sequences:	652 (517)
Seq/√Len:	60.1
META:	0.313

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
4_R	7_A	4.098	1.00
11_D	14_G	2.678	1.00
10_W	14_G	2.406	1.00
67_D	72_E	2.377	1.00
3_R	7_A	2.365	1.00
11_D	15_G	2.344	1.00
34_Y	73_E	2.164	1.00
71_T	74_Q	2.117	1.00
15_G	18_K	2.006	1.00
11_D	16_K	1.805	1.00
10_W	13_E	1.785	0.99
72_E	76_L	1.782	0.99
5_E	8_E	1.615	0.99
65_K	74_Q	1.582	0.99
4_R	9_E	1.548	0.98
30_L	34_Y	1.520	0.98
47_E	50_E	1.499	0.98
33_W	73_E	1.466	0.98
12_E	15_G	1.462	0.98
14_G	18_K	1.354	0.96
30_L	56_R	1.349	0.96
30_L	37_D	1.347	0.96
58_A	62_K	1.299	0.95
39_N	42_E	1.288	0.95
3_R	6_E	1.281	0.95
13_E	16_K	1.229	0.94
11_D	18_K	1.217	0.94
12_E	16_K	1.194	0.93
21_P	54_Y	1.185	0.93
6_E	23_R	1.150	0.91
5_E	9_E	1.145	0.91
44_E	48_E	1.109	0.90
2_R	5_E	1.098	0.89
69_G	73_E	1.096	0.89
30_L	35_L	1.058	0.88
33_W	60_E	1.058	0.88
11_D	17_G	1.030	0.86
37_D	54_Y	1.019	0.86
34_Y	74_Q	0.989	0.84
43_E	46_K	0.973	0.83
25_M	54_Y	0.966	0.82
67_D	73_E	0.931	0.80
64_V	69_G	0.930	0.80
32_E	68_D	0.928	0.80
34_Y	65_K	0.921	0.79
69_G	74_Q	0.904	0.78
54_Y	57_G	0.882	0.76
41_E	44_E	0.880	0.76
19_P	74_Q	0.848	0.73
10_W	16_K	0.833	0.72
34_Y	57_G	0.829	0.72
22_P	26_E	0.826	0.71
71_T	75_W	0.805	0.69
36_K	62_K	0.804	0.69
40_E	43_E	0.798	0.69
50_E	53_E	0.796	0.69
37_D	72_E	0.788	0.68
31_P	64_V	0.772	0.66
34_Y	37_D	0.755	0.64
26_E	71_T	0.755	0.64
44_E	49_E	0.740	0.63
28_D	35_L	0.735	0.62
16_K	20_R	0.729	0.62
22_P	28_D	0.725	0.61
62_K	65_K	0.708	0.59
30_L	72_E	0.699	0.58
25_M	68_D	0.698	0.58
42_E	46_K	0.697	0.58
15_G	20_R	0.682	0.57
67_D	70_L	0.677	0.56
10_W	17_G	0.671	0.55
10_W	15_G	0.667	0.55
15_G	19_P	0.660	0.54
41_E	70_L	0.657	0.54
23_R	62_K	0.652	0.53
60_E	63_E	0.650	0.53
25_M	74_Q	0.646	0.53
37_D	41_E	0.640	0.52
47_E	52_E	0.633	0.51
23_R	74_Q	0.631	0.51
33_W	63_E	0.630	0.51
51_E	54_Y	0.628	0.51
5_E	46_K	0.623	0.50
6_E	9_E	0.609	0.48
4_R	8_E	0.604	0.48
13_E	17_G	0.589	0.46
27_E	57_G	0.588	0.46
14_G	17_G	0.586	0.46
16_K	75_W	0.586	0.46
54_Y	67_D	0.584	0.46
51_E	64_V	0.577	0.45
27_E	55_G	0.572	0.44
37_D	75_W	0.571	0.44
58_A	61_R	0.568	0.44
46_K	49_E	0.566	0.44
19_P	75_W	0.559	0.43
18_K	21_P	0.559	0.43
50_E	54_Y	0.558	0.43
29_E	75_W	0.556	0.43
42_E	45_E	0.554	0.42
27_E	70_L	0.539	0.41
56_R	60_E	0.538	0.41
23_R	33_W	0.530	0.40
50_E	56_R	0.530	0.40
53_E	61_R	0.521	0.39
27_E	72_E	0.517	0.38
20_R	35_L	0.515	0.38
32_E	52_E	0.505	0.37
26_E	35_L	0.503	0.37
41_E	45_E	0.500	0.37
14_G	20_R	0.500	0.37

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2yu1A	1	0	7.1	0.886	Contact Map
3wxwA	1	0.5921	6.2	0.889	Contact Map
1qb3A	2	0.7763	3.4	0.902	Contact Map
3qy2A	4	0.8421	2.7	0.908	Contact Map
3gjxB	1	0.6447	2.4	0.909	Contact Map
4f1nA	1	0.8026	2.1	0.912	Contact Map
4mp0B	1	0.2105	2.1	0.912	Contact Map
3cxjA	3	0.7763	1.9	0.914	Contact Map
4kreA	1	0.7763	1.9	0.914	Contact Map
2yhbA	1	0.8421	1.9	0.915	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0045 seconds.