SseB_C - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SseB_C - SseB protein C-terminal domain

PFAM:	PF14581	Sequences: IEKGTQVLLGEPAEYPTELVAALSALFAKRPEVRAAYLALVQVPGEEPHLLIGVELDGDWEELVRAAGEVAAGALPDGEPVDFVPLDDEQGVSDWLLENVRPFYER	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	106 (104)
Sequences:	2185 (1598)
Seq/√Len:	156.7
META:	0.759

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
27_F	36_A	4.358	1.00
34_R	55_E	3.369	1.00
15_Y	20_V	2.867	1.00
23_L	27_F	2.585	1.00
30_R	66_A	2.536	1.00
27_F	67_A	2.518	1.00
26_L	30_R	2.345	1.00
27_F	33_V	2.285	1.00
26_L	66_A	2.265	1.00
36_A	103_F	2.148	1.00
52_I	83_F	2.148	1.00
34_R	57_D	2.024	1.00
53_G	86_L	2.019	1.00
93_S	96_L	1.848	1.00
61_E	65_R	1.794	1.00
26_L	70_V	1.739	1.00
41_V	51_L	1.624	1.00
10_G	40_L	1.601	1.00
9_L	41_V	1.536	1.00
17_T	21_A	1.532	1.00
35_A	105_E	1.491	1.00
66_A	69_E	1.451	1.00
101_R	105_E	1.445	1.00
18_E	21_A	1.442	1.00
49_H	82_D	1.439	1.00
22_A	25_A	1.427	1.00
67_A	83_F	1.415	1.00
52_I	81_V	1.401	1.00
95_W	99_N	1.388	1.00
30_R	63_L	1.386	1.00
40_L	50_L	1.368	1.00
92_V	95_W	1.361	1.00
53_G	96_L	1.361	1.00
42_Q	45_G	1.313	1.00
16_P	20_V	1.311	1.00
88_D	93_S	1.278	1.00
90_Q	94_D	1.248	1.00
27_F	103_F	1.229	1.00
56_L	60_W	1.226	1.00
95_W	98_E	1.203	1.00
67_A	71_A	1.191	1.00
39_A	100_V	1.180	1.00
21_A	25_A	1.146	1.00
86_L	97_L	1.141	1.00
60_W	85_P	1.082	0.99
54_V	85_P	1.080	0.99
75_L	78_G	1.076	0.99
94_D	98_E	1.069	0.99
13_A	16_P	1.059	0.99
8_L	42_Q	1.058	0.99
20_V	24_S	1.056	0.99
75_L	80_P	1.036	0.99
26_L	63_L	1.030	0.99
40_L	48_P	0.995	0.99
14_E	17_T	0.983	0.99
50_L	53_G	0.976	0.99
12_P	15_Y	0.974	0.99
5_T	8_L	0.972	0.99
75_L	81_V	0.972	0.99
59_D	62_E	0.965	0.99
51_L	82_D	0.955	0.99
64_V	83_F	0.933	0.98
27_F	54_V	0.898	0.98
22_A	70_V	0.895	0.98
11_E	100_V	0.874	0.97
24_S	28_A	0.861	0.97
34_R	106_R	0.839	0.97
28_A	104_Y	0.818	0.96
36_A	54_V	0.811	0.96
62_E	65_R	0.807	0.96
39_A	51_L	0.805	0.96
11_E	15_Y	0.796	0.96
76_P	79_E	0.785	0.95
17_T	20_V	0.783	0.95
56_L	85_P	0.780	0.95
60_W	64_V	0.768	0.95
14_E	79_E	0.755	0.94
12_P	40_L	0.750	0.94
25_A	32_E	0.750	0.94
37_Y	86_L	0.746	0.94
5_T	43_V	0.745	0.94
18_E	74_A	0.744	0.94
26_L	29_K	0.737	0.93
3_K	7_V	0.733	0.93
38_L	52_I	0.728	0.93
35_A	86_L	0.728	0.93
35_A	55_E	0.719	0.92
96_L	99_N	0.710	0.92
43_V	49_H	0.708	0.92
99_N	105_E	0.706	0.92
92_V	96_L	0.704	0.92
93_S	97_L	0.697	0.91
75_L	79_E	0.691	0.91
96_L	100_V	0.690	0.91
89_E	93_S	0.689	0.91
20_V	38_L	0.685	0.90
42_Q	48_P	0.680	0.90
55_E	93_S	0.673	0.90
6_Q	44_P	0.671	0.90
62_E	66_A	0.670	0.90
14_E	20_V	0.669	0.89
66_A	70_V	0.659	0.89
70_V	74_A	0.658	0.89
41_V	82_D	0.656	0.89
17_T	24_S	0.652	0.88
11_E	95_W	0.648	0.88
29_K	34_R	0.642	0.87
10_G	13_A	0.641	0.87
91_G	94_D	0.633	0.87
19_L	76_P	0.625	0.86
75_L	82_D	0.621	0.86
90_Q	93_S	0.620	0.86
29_K	78_G	0.616	0.85
46_E	88_D	0.610	0.85
69_E	72_A	0.598	0.83
22_A	55_E	0.597	0.83
13_A	17_T	0.595	0.83
36_A	52_I	0.595	0.83
39_A	96_L	0.593	0.83
94_D	101_R	0.593	0.83
47_E	80_P	0.588	0.82
51_L	84_V	0.586	0.82
42_Q	50_L	0.584	0.82
66_A	73_G	0.582	0.82
41_V	49_H	0.581	0.82
14_E	33_V	0.577	0.81
33_V	67_A	0.574	0.81
28_A	31_P	0.573	0.81
39_A	97_L	0.570	0.80
68_G	83_F	0.570	0.80
44_P	72_A	0.566	0.80
23_L	68_G	0.559	0.79
44_P	74_A	0.558	0.79
41_V	75_L	0.558	0.79
34_R	46_E	0.556	0.79
36_A	67_A	0.548	0.78
3_K	45_G	0.548	0.78
49_H	80_P	0.542	0.77
55_E	88_D	0.542	0.77
18_E	76_P	0.540	0.77
36_A	63_L	0.536	0.76
21_A	106_R	0.532	0.76
9_L	86_L	0.530	0.76
5_T	13_A	0.529	0.75
52_I	55_E	0.529	0.75
10_G	82_D	0.527	0.75
34_R	101_R	0.526	0.75
58_G	61_E	0.526	0.75
64_V	73_G	0.521	0.74
7_V	11_E	0.514	0.73
70_V	73_G	0.508	0.72
16_P	71_A	0.506	0.72
33_V	104_Y	0.502	0.72
34_R	105_E	0.501	0.71
34_R	58_G	0.501	0.71
61_E	77_D	0.500	0.71

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2rffA	1	0.934	79.5	0.801	Contact Map
1no5A	4	0.9057	45.4	0.841	Contact Map
3c18A	2	0.783	33.2	0.853	Contact Map
1wotA	1	0.8774	22.5	0.865	Contact Map
2pbeA	1	0.783	18.6	0.87	Contact Map
1ylqA	2	0.8113	15.7	0.874	Contact Map
4d4iA	1	0.6509	11.4	0.882	Contact Map
4kgbA	2	0.9057	11	0.882	Contact Map
3ivrA	2	0.0094	10.9	0.883	Contact Map
2ahuA	3	0.9528	10.9	0.883	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.