ABC_trans_N - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ABC_trans_N - ABC-transporter extracellular N-terminal

PFAM:	PF14510	Sequences: LARTLTRQSKEVDVSNLGLQERDSLLDPLSAEFDNEKWLKKLRNRIDRVGIELPRTIGVRFENLNVEGVGVGTRYQPTVGNVLLN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	85 (77)
Sequences:	1855 (1280)
Seq/√Len:	145.9
META:	0.171

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
8_Q	11_E	2.407	1.00
13_D	16_N	2.385	1.00
35_N	39_L	2.086	1.00
74_R	81_N	1.997	1.00
30_S	33_F	1.989	1.00
36_E	40_K	1.917	1.00
24_S	32_E	1.891	1.00
12_V	15_S	1.883	1.00
28_P	33_F	1.805	1.00
23_D	27_D	1.759	1.00
33_F	68_G	1.746	1.00
61_F	64_L	1.623	1.00
40_K	44_N	1.598	1.00
14_V	17_L	1.569	1.00
28_P	76_Q	1.567	1.00
43_R	57_I	1.547	1.00
8_Q	12_V	1.523	1.00
69_V	74_R	1.513	1.00
30_S	38_W	1.512	1.00
13_D	18_G	1.500	1.00
28_P	38_W	1.482	1.00
77_P	82_V	1.457	1.00
77_P	81_N	1.443	1.00
43_R	47_D	1.430	1.00
34_D	51_I	1.403	1.00
9_S	30_S	1.349	1.00
46_I	56_T	1.307	1.00
42_L	46_I	1.279	1.00
24_S	27_D	1.247	1.00
73_T	81_N	1.216	1.00
50_G	54_P	1.203	1.00
79_V	83_L	1.197	1.00
21_E	27_D	1.189	1.00
39_L	57_I	1.155	1.00
45_R	59_V	1.140	0.99
35_N	41_K	1.138	0.99
79_V	82_V	1.137	0.99
69_V	77_P	1.137	0.99
16_N	19_L	1.136	0.99
70_G	74_R	1.099	0.99
46_I	53_L	1.066	0.99
69_V	73_T	1.064	0.99
10_K	20_Q	1.039	0.99
45_R	48_R	1.037	0.99
14_V	18_G	1.029	0.99
46_I	54_P	1.009	0.99
61_F	83_L	1.003	0.99
34_D	37_K	0.981	0.98
75_Y	81_N	0.953	0.98
38_W	67_E	0.946	0.98
25_L	37_K	0.934	0.98
60_R	64_L	0.912	0.97
44_N	48_R	0.895	0.97
27_D	38_W	0.894	0.97
35_N	59_V	0.888	0.97
36_E	60_R	0.879	0.97
21_E	32_E	0.878	0.97
10_K	13_D	0.853	0.96
27_D	30_S	0.841	0.96
55_R	66_V	0.839	0.96
8_Q	19_L	0.836	0.96
14_V	19_L	0.830	0.96
57_I	71_V	0.829	0.96
25_L	29_L	0.824	0.95
34_D	45_R	0.821	0.95
10_K	24_S	0.798	0.95
51_I	71_V	0.759	0.93
43_R	54_P	0.748	0.93
24_S	84_L	0.745	0.92
45_R	54_P	0.740	0.92
47_D	54_P	0.739	0.92
15_S	20_Q	0.718	0.91
38_W	70_G	0.707	0.90
28_P	65_N	0.707	0.90
29_L	59_V	0.705	0.90
39_L	54_P	0.704	0.90
57_I	64_L	0.689	0.89
39_L	55_R	0.685	0.89
42_L	55_R	0.684	0.89
39_L	62_E	0.676	0.88
35_N	61_F	0.674	0.88
50_G	53_L	0.672	0.88
36_E	51_I	0.669	0.88
38_W	76_Q	0.662	0.87
45_R	77_P	0.659	0.87
33_F	40_K	0.644	0.86
66_V	70_G	0.643	0.86
55_R	77_P	0.637	0.85
52_E	83_L	0.634	0.85
27_D	68_G	0.626	0.84
43_R	59_V	0.624	0.84
47_D	52_E	0.621	0.84
33_F	58_G	0.616	0.83
61_F	72_G	0.614	0.83
73_T	77_P	0.606	0.82
42_L	47_D	0.601	0.81
33_F	38_W	0.600	0.81
39_L	67_E	0.583	0.80
48_R	51_I	0.582	0.79
20_Q	24_S	0.581	0.79
28_P	79_V	0.580	0.79
15_S	18_G	0.579	0.79
80_G	84_L	0.573	0.78
76_Q	79_V	0.558	0.77
49_V	62_E	0.558	0.77
10_K	63_N	0.556	0.76
61_F	79_V	0.555	0.76
15_S	68_G	0.552	0.76
12_V	16_N	0.537	0.74
56_T	60_R	0.519	0.71
15_S	19_L	0.514	0.71
20_Q	63_N	0.511	0.70
75_Y	80_G	0.509	0.70
43_R	55_R	0.505	0.69
52_E	56_T	0.501	0.69
49_V	57_I	0.500	0.68

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1unnC	1	0.8235	6.6	0.901	Contact Map
2qtcA	2	0.0706	6.1	0.902	Contact Map
2im5A	1	0.9529	5.9	0.903	Contact Map
3mfiA	1	0.7765	4.6	0.908	Contact Map
3os4A	1	0.9412	4.3	0.909	Contact Map
3sscA	1	0.6118	4.2	0.909	Contact Map
1vjuA	1	0.9294	4	0.91	Contact Map
4pl9A	1	0.6941	3.8	0.912	Contact Map
3j4aA	3	0.9412	3.5	0.913	Contact Map
4tqrA	1	0.7294	3.4	0.913	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.